KEGG   Bacillus subtilis subsp. subtilis 168: BSU35500Help
Entry
BSU35500          CDS       T00010                                 

Gene name
degS
Definition
(RefSeq) signal transduction histidine-protein kinase/phosphatase DegS
  KO
K07777  two-component system, NarL family, sensor histidine kinase DegS [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00478  DegS-DegU (multicellular behavior control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU35500 (degS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU35500 (degS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU35500 (degS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU35500 (degS)
Protein kinases [BR:bsu01001]
 Histidine kinases
  NarL family
   BSU35500 (degS)
Two-component system [BR:bsu02022]
 NarL family
  DegS-DegU [MD:M00478]
   BSU35500 (degS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegS HisKA_3 HATPase_c HATPase_c_2 YabA HATPase_c_5 Nmad5 Baculo_PEP_C Lipoprotein_7 HATPase_c_3 SPOB_ab TMPIT KASH_CCD
Motif
Other DBs
NCBI-GeneID: 936752
NCBI-ProteinID: NP_391430
Pasteur: BG10392
BSORF: BG10392
UniProt: P13799
Position
complement(3645379..3646536)
Genome map
AA seq 385 aa AA seqDB search
MNKTKMDSKVLDSILMKMLKTVDGSKDEVFQIGEQSRQQYEQLVEELKQIKQQVYEVIEL
GDKLEVQTRHARNRLSEVSRNFHRFSEEEIRNAYEKAHKLQVELTMIQQREKQLRERRDD
LERRLLGLQEIIERSESLVSQITVVLNYLNQDLREVGLLLADAQAKQDFGLRIIEAQEEE
RKRVSREIHDGPAQMLANVMMRSELIERIFRDRGAEDGFQEIKNLRQNVRNALYEVRRII
YDLRPMALDDLGLIPTLRKYLYTTEEYNGKVKIHFQCIGETEDQRLAPQFEVALFRLAQE
AVSNALKHSESEEITVKVEITKDFVILMIKDNGKGFDLKEAKEKKNKSFGLLGMKERVDL
LEGTMTIDSKIGLGTFIMIKVPLSL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaaagatggattccaaagtgctggattctattttgatgaagatgctgaaa
accgttgacgggagcaaggacgaggtttttcaaatcggggagcagtcacgccagcagtat
gaacagctggtcgaagaactgaaacaaattaaacagcaggtgtatgaagtgattgagctt
ggcgataaacttgaagtgcaaactcgccatgcgagaaaccgtttatccgaggtcagccgt
aattttcatagattcagtgaagaggaaatccgcaatgcttatgaaaaagcccataagctg
caggtagaattgacgatgatccagcagcgtgagaagcaattgcgcgaacggcgggacgat
ttggagcgcagattgctagggcttcaggaaatcattgagcggtcagaatcattagtaagc
caaattacagttgtgctcaactacttgaatcaggatttgcgcgaagttggactgcttctt
gctgatgctcaggcaaaacaggatttcggcttaagaattattgaggcgcaggaagaagag
cgaaaaagagtctcaagagaaatccatgacggacccgctcaaatgctggcgaatgttatg
atgagatcggaattaatcgagcggattttccgtgaccggggcgcagaggacggattccaa
gaaattaaaaatctccgccaaaatgttcggaatgccctttacgaagtgagaaggattata
tatgatttaagaccgatggcccttgatgacctaggcctgattccaactttaagaaaatat
ctatatacaaccgaggaatataacgggaaggtcaaaatacattttcagtgcattggagaa
acagaggatcagaggctagcgcctcagtttgaggttgcgctcttcaggctcgcacaggaa
gctgtgtctaatgcgctaaagcattctgaatctgaagaaattacagtcaaagttgagatc
acaaaggattttgtgattttaatgataaaagataacggtaaagggttcgacctgaaggaa
gcgaaagagaagaaaaacaaatcattcggcttgctgggcatgaaagaaagagtagattta
ttggaaggaacgatgacaatagattcgaaaataggtcttgggacatttattatgattaag
gttccgttatctctttga

DBGET integrated database retrieval system