KEGG   Bacillus subtilis subsp. subtilis 168: BSU35560Help
Entry
BSU35560          CDS       T00010                                 

Gene name
tuaF
Definition
(RefSeq) teichuronic acid biosynthesis protein TuaF
  KO
K16706  teichuronic acid biosynthesis protein TuaF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99986 Glycan metabolism
    BSU35560 (tuaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz HlyD_2 MtrF
Motif
Other DBs
NCBI-GeneID: 936768
NCBI-ProteinID: NP_391436
Pasteur: BG12693
BSORF: BG12693
UniProt: O32269
Position
complement(3651879..3652559)
Genome map
AA seq 226 aa AA seqDB search
MNDILIRIARRIKKNIIWIIAVPIILGAAGYILPSQIADQKSYTAEDTLAVGSYDHPVYN
STEEIPLLLKSDSFLKEALPDEKDEDVAEIKEKLTINTESKSLLTLSYSDEDKDRTESVL
NAISSTFLKNDQKLYAEREAVIRSSIDALEGESVSEDSKVDKERFLYELKNTQLNLKAAS
VTDSETVSETAGGGMSPKKKAVLGVMIGLTIAFMFVVIPEFFRESF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatatattgataagaatagcccgtcgcataaaaaaaaatatcatttggatcata
gcggtgccaattatattaggtgcggcggggtatatcctgccgtcacagatcgctgatcaa
aagagctatacagctgaagatactttggctgtggggagctatgatcatccggtttataac
agcacagaagagattccgcttctattaaagagcgactcctttttgaaggaggcgcttcct
gatgaaaaggatgaagatgtagcagagatcaaagagaagcttacaatcaatacggaatcc
aaatcgttactgactttaagctatagtgacgaggataaggatagaacggaatctgtctta
aacgccatatcctccaccttcctcaaaaacgatcaaaagctgtatgcagaaagagaagcc
gtcatccgcagcagcatagacgcgcttgaaggcgagtcggtgagcgaggattccaaagtg
gataaagagagatttttatatgaactcaaaaacacacagcttaacctgaaagcggcaagt
gttactgattccgaaaccgtaagtgagacagcaggcggcggtatgtctccgaaaaagaaa
gcagttctcggcgttatgattggccttacgattgcctttatgttcgttgtcattcctgaa
tttttcagagaatccttttaa

DBGET integrated database retrieval system