KEGG   Bacillus subtilis subsp. subtilis 168: BSU36270
Entry
BSU36270          CDS       T00010                                 

Gene name
ywqB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: SWIM AEP1 DUF515 CoA_binding_3
Other DBs
NCBI-GeneID: 936903
NCBI-ProteinID: NP_391508
Pasteur: BG12506
BSORF: BG12506
UniProt: P96714 A0A6M3ZHU0
Position
3733852..3735462
AA seq 536 aa
MLQNMISKDDVLASAEQLKELLPYNEENVQLIKKALILYRQDSVYRLQAVSPTEVTAYVQ
DVVPVRVTLNLFVIVKSGCSCPSGRICRHMLAVFLYVYAMFERVGTFTEYWLEREKLEES
KELVRRQFQEKVLPNEESLSSWLAFFDSEFSLWQARTPEGSQNMQGLYYGYLSALKKHAP
NKPELKSLYQIHSAIAVWLRMFTLIEAGKLNPEQDFYSLNPYVEQLMDTIYSSIDKLKTY
ALSFALDPFLDKTPDVIRHLLLKEEIFQYERIRVFGEIWSALLSRPKWVAREQEILKKEA
GRRFSPELQFGRLHLEFLQKNDDVIFEEADQFPPEALPYTFQWLSEMTAKKDWKRLKTWY
QQIEPIAMGYTKLDKPFKEIRDVIGELFLLLNAYVQQTNDQALFERFAAGCLPYTFTEYS
HHLYEKKRYAEWIEIHSLVGFSINEMDKMMLKEIAASDPEALIPAYHREVAFFIDQKNRS
SYKEAARYLKKLRTLYKKAKKQKVWERYIQLLSSHYKRLRALQEELQKGKLIDGES
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgcttcagaatatgatttccaaagacgatgtgctggcatctgctgaacagttaaaagaa
cttcttccttacaatgaggaaaatgttcagctgatcaaaaaagcccttattttatatcgg
caggattcagtctatcgtttacaagcagtgagtccgacggaagttacggcttacgtgcag
gatgttgtgcctgtgcgggtcacattgaacttgtttgtcatagtcaaaagcggctgttca
tgtccgtccggaagaatctgccgccatatgctggctgtgtttttatatgtatatgcaatg
ttcgagcgagtgggtacttttacagagtattggctggagagggaaaagcttgaggaaagc
aaagagctcgtccgccgccagtttcaggaaaaggtgctgcctaatgaagaatcactttca
agctggcttgctttttttgattcagagttttctctctggcaggcacgtacgccagaaggc
agccaaaacatgcagggcctctattacggctacctgtccgcattaaaaaaacatgcgccg
aacaagccggagctgaaaagcctgtatcagattcattccgcgattgcggtttggcttcgc
atgttcacattgattgaagcgggcaagctaaaccccgaacaagatttttattccctcaat
ccgtacgttgaacagctgatggatacaatctacagctctattgataaattaaaaacgtac
gcgctgtcttttgcgcttgatccgtttttggataaaacaccggatgttatccggcatttg
ctgttgaaagaagaaattttccaatatgaacgcatccgcgtcttcggtgaaatttggagt
gcgctgctgtcgcggccaaaatgggtggcacgcgaacaggagatattgaaaaaagaagca
ggacggcgtttttctcccgaattgcaattcgggcgcctgcatttggaattcctgcaaaaa
aatgatgacgttatttttgaggaagcggatcaattcccgccggaagcgctcccttataca
ttccaatggctgagtgaaatgactgccaagaaggactggaaacggcttaaaacatggtac
cagcaaattgaaccaattgcgatgggttatacgaagctggataagccgtttaaagagatt
cgcgatgtgatcggcgagctgttccttctgttgaatgcctatgtgcagcaaaccaatgat
caagcgctgtttgagcgctttgccgcgggctgtctgccgtatacgttcacagaatacagc
catcatttatatgaaaaaaaacgctatgccgagtggattgaaattcatagccttgtcggc
ttttccatcaatgaaatggataaaatgatgctcaaggaaattgcagcgagcgaccctgag
gcgcttataccggcttaccatagagaagtggcttttttcattgatcagaagaaccgtagc
tcgtacaaggaagccgcccggtatttgaaaaaattgcgcaccctgtacaaaaaagcgaaa
aagcagaaggtgtgggagcggtatattcagctgctgagctcgcattacaagcgcctgcgt
gcgcttcaagaagaactgcagaaaggaaagttgattgatggcgagtcttaa

DBGET integrated database retrieval system