KEGG   Bacillus subtilis subsp. subtilis 168: BSU36560
Entry
BSU36560          CDS       T00010                                 

Symbol
ywnH
Name
(RefSeq) phosphinothricin acetyltransferase YwnH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_4 Acetyltransf_3 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_CG PanZ
Other DBs
NCBI-GeneID: 936956
NCBI-ProteinID: NP_391537
Pasteur: BG12486
BSORF: BG12486
UniProt: P71043 A0A6M3ZIV8
Structure
PDB: 
1VHS

Position
3760694..3761185
AA seq 163 aa
MTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENG
NVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFI
FGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELS
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacattgcgtcttgctgaacatagagacttggaggctgttgtggcgatttataattca
acgattgcttctcgaatggtaacagccgataccgaaccggtaactcctgaagaccggatg
gaatggttttcgggacatacagagtcacgtccgctctatgtggccgaggatgaaaacgga
aacgtcgctgcctggatcagctttgaaacattttatggaaggccagcctataataaaaca
gcggaagtcagcatatacattgacgaagcatgccgcggcaaaggtgttggatcatatttg
cttcaagaagcgctccgcattgccccgaatcttggcatccgctcacttatggccttcatt
ttcgggcataataaaccaagcctgaagctgtttgaaaagcacgggtttgcagaatgggga
ctattccccggcatcgccgaaatggacgggaaaagatacgatttaaaaattttagggaga
gagctttcatga

DBGET integrated database retrieval system