KEGG   Bacillus subtilis subsp. subtilis 168: BSU36590
Entry
BSU36590          CDS       T00010                                 

Symbol
clsA
Name
(RefSeq) cardiolipin synthase
  KO
K06131  cardiolipin synthase A/B [EC:2.7.8.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU36590 (clsA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     BSU36590 (clsA)
SSDB
Motif
Pfam: PLDc_2 PLDc PLDc_N DUF3810 AA_permease_2 DUF2484 Gtr1_RagA ATG27
Other DBs
NCBI-GeneID: 936957
NCBI-ProteinID: NP_391540
Pasteur: BG12483
BSORF: BG12483
UniProt: P71040 A0A6M3ZLA7
Position
3762664..3764112
AA seq 482 aa
MSISSILLSLFFILNILLAIIVIFKERRDASASWAWLLVLFFIPVLGFILYLLFGHNLRR
KHLFQWEDRKKIGIERLLKHQLEDLETKQFQFNNRATFDNKDLIYMLIMNNHAVFTEDNS
VDVITDGRDKFQRLLSDISKAKDHIHLQYYIYKGDELGKKLRDALIQKAKEGVQVRVLYD
ELGSRTLRKKFFKELREAGGHVEVFFPSKLRPINLRLNYRNHRKLVIIDGMTGYVGGFNV
GDEYLGLNPKFGYWRDTHIRLQGTAVHAIQTRFILDWNQASHHHTLTYIPNHFPDYGPKG
NVGMQIVTSGPDSEWEQIKNGYIKMISNAKRSILIQTPYFIPDASLLDALRIACLSGIDV
NIMIPNKPDHAFVYWATLSYIGDLLKAGATVYIYDNGFIHAKTIVVDDEIASVGTANIDV
RSFRLNFEVNAFIYDITIAKKLVSTFKEDLLVSRKFTYEEYLQRPLWIRIKESVSRLLSP
IL
NT seq 1449 nt   +upstreamnt  +downstreamnt
gtgagtatttcttccatccttttatcactttttttcattttaaatattcttttggccatc
attgtcatcttcaaagaacggcgcgatgccagtgcatcttgggcgtggctgcttgttctt
ttctttattcccgttttaggctttattttatacttattattcggccataatctcagacgc
aagcatttgtttcaatgggaagaccggaaaaagattggaattgaaaggctgctgaagcat
cagcttgaagatttagaaaccaagcaatttcagtttaacaaccgggcaacctttgataac
aaagatttaatttatatgctgattatgaataaccatgctgtgtttacagaggataattca
gttgacgtcattacagatggacgggataaatttcagcggctgctgagtgacatttcaaag
gctaaggatcatatccatttacagtattatatttataaaggcgatgaattaggcaaaaaa
ttgcgggacgctctcatccaaaaggcgaaagaaggtgttcaggtcagagtgctttatgat
gaactcgggtccagaacgctgagaaaaaagttttttaaagagcttcgcgaggctggcggg
catgtggaggtctttttcccgtcaaagctcaggccgattaacctgcggctgaattaccgg
aaccatcgaaagcttgtgatcatagacggtatgaccggttatgtcggaggctttaacgtc
ggagatgagtatctagggcttaatccgaaattcggttattggcgggatacgcatatccgg
ctgcaaggaacggccgtgcacgccatccaaacacgattcatccttgactggaaccaagct
tctcatcaccatacgctgacatatattccaaatcactttcctgattacggcccaaaaggc
aacgtcgggatgcagattgtcacaagcggccctgattcggaatgggaacaaattaaaaat
ggctacatcaaaatgatttcgaacgccaagcgttccattttgatacaaacaccttatttt
atcccagatgcaagcctgctggatgctttaaggatcgcttgcctttcgggcattgacgtt
aacattatgattccgaacaagcccgatcacgcctttgtatactgggcgacactttcgtat
atcggcgatctgctgaaagccggagccactgtctatatttacgataacggctttattcac
gcgaaaaccatcgtggtggatgacgaaatcgcttcagtcggcacagcgaacattgatgtc
cgaagcttcaggctgaattttgaggttaatgcatttatttacgatatcaccattgctaaa
aaactggtttcaacttttaaagaagatttgctagtatccagaaaattcacctatgaggag
tatctgcagcgcccgttgtggattcgaataaaagaatccgtctcgcggctgttgtcgccg
atcttataa

DBGET integrated database retrieval system