KEGG   Bacillus subtilis subsp. subtilis 168: BSU36640Help
Entry
BSU36640          CDS       T00010                                 

Gene name
ureC
Definition
(RefSeq) urease subunit alpha
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU36640 (ureC)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU36640 (ureC)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    BSU36640 (ureC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     BSU36640 (ureC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 936958
NCBI-ProteinID: NP_391545
Pasteur: BG11983
BSORF: BG11983
UniProt: P77837
Position
complement(3766714..3768423)
Genome map
AA seq 569 aa AA seqDB search
MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRI
TGKDGALDLVITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTE
VISGEGKILTAGGVDTHIHFICPQQMEVALSSGVTTLLGGGTGPATGSKATTCTSGAWYM
ARMLEAAEEFPINVGFLGKGNASDKAPLIEQVEAGAIGLKLHEDWGTTPSAIKTCMEVVD
EADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAGGGHAPDIMKLASYANILPSS
TTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDILHDIGAISMT
SSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYA
SYGKANRSTSITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDP
KTYQVFADGEELSCQPVDYVPLGQRYFLF
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtcacgggaggaatatgcggaactgtttggcccgacaacgggcgataaaatc
agattgggcgacacggatttatggatcgaagtcgaaaaggatttcacagtatacggtgaa
gaaatgatctttggcggcggaaaaactatccgagacggcatgggccaaaacggcagaatc
acagggaaggacggcgctttggatttggttatcaccaacgtcgtgctattggattacaca
ggcattgtcaaagcggatgtcggtgtgaaagacggccggattgtcggtgtcggaaaaagc
ggaaatcctgatatcatggatggagtcgatccgcacatggtcatcggagcggggacagag
gtgatttccggtgaaggcaaaattttaacagccgggggagtggacacgcacattcatttt
atttgtcctcagcagatggaagttgcgctttcttcaggtgtgacgacccttttgggaggc
ggaacaggacccgctacaggaagcaaagcgacaacatgtacgtccggggcgtggtatatg
gcgaggatgctggaagcggccgaggagtttccgatcaatgtcggcttcttaggaaaaggg
aatgcatccgataaagcgccgctgatcgagcaggtggaagcaggcgccatcggtcttaag
ctccatgaagactggggaacgacgccaagcgccattaaaacgtgtatggaagtcgtggac
gaggctgatattcaagttgccatccataccgatacgattaacgaagcgggctttttggaa
aacacgctcgacgcgatcggggaccgggttattcatacttatcacattgaaggggcaggc
ggcggtcacgctccggatattatgaagctcgcctcttacgcgaacattctgccgtcatct
acaacgccaaccattccttataccgttaatacgatggatgagcatcttgacatgatgatg
gtctgccaccatttagatgcgaaagtgcctgaagatgtggcattcagccattccagaatc
agggcggcgacgattgccgcggaggatattctccatgatataggtgcgatcagcatgaca
tcatcggattcccaagcgatggggcgggtcggtgaagtgatcatccgaacatggcaggta
gccgataaaatgaaaaaacagcgcggcgctcttgccggtgaaaacgggaatgacaatgtg
cgcgcaaaacggtacattgccaaatacacgattaatccggcaattacgcacgggctcagc
catgaggtcggctcggtggaaaaagggaagcttgctgatctcgttctgtgggacccggta
tttttcggcgtgaaaccggaactggtcttaaagggcggcatgattgcacgtgcgcaaatg
ggagatccgaacgcgtccatcccgactcctgaaccggttttcatgcgccaaatgtatgcg
tcttacggaaaagccaaccgctcaacctcgattacatttatgtctcaggcaagcatagag
cgtggtgtggcggaaagcttagggctggaaaaaaggatttctccagtcaaaaatatcaga
aagctgagcaagctggatatgaagctgaattcggctttgccgaagattgagattgatcca
aaaacctatcaggtctttgctgacggggaggaattgtcttgccagcctgtcgattatgtc
ccacttggacaaagatatttcttattttga

DBGET integrated database retrieval system