KEGG   Bacillus subtilis subsp. subtilis 168: BSU37230
Entry
BSU37230          CDS       T00010                                 

Symbol
ywjA
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37230 (ywjA)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU37230 (ywjA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase DEAD ABC_membrane_3 AAA_22 AAA_30 AAA AAA_29 AAA_18 SbcCD_C MMR_HSR1 Cytidylate_kin GST_C_3 AAA_25
Other DBs
NCBI-GeneID: 937049
NCBI-ProteinID: NP_391604
Pasteur: BG11306
BSORF: BG11306
UniProt: P45861 A0A6M3ZHG6
Position
complement(3819754..3821481)
AA seq 575 aa
MLRQFFSYYKPYKTLFFLDFFSAIAGGLMELSFPLIVNYFIDTLLPGRDWGLIIATSIGL
FAVYALSSALQYIVTYWGHMLGINIETDMRKSLFDHLQKLSFKFYDNNKTGTLMSKLTND
LMYIGEVAHHGPEDLFIAVMTILGAFGVMLFINWQLALLTFIIMPIVIWLALYFNKKMTK
AFTTLNKDIGDFSARVENNIGGIRLVQAFGNEAFEKERFAVNNQRFRVTKLSSYKIMAKN
GSISYMLTRFVTLFVLLCGTWFVIRGSLSYGEFVAFVLLTNVLFRPIDKINAIIEMYPRG
IAGFKSYMELMETEPDIQDSPDSKDVSGLKGNIRYKHVSFGYDDHHNVLNDINLSIQAGE
TVAFVGPSGAGKSTLCSLLPRFYEASEGDITIDGISIKDMTLSSLRGQIGVVQQDVFLFS
GTLRENIAYGRLGASEEDIWQAVKQAHLEELVHNMPDGLDTMIGERGVKLSGGQKQRLSI
ARMFLKNPSILILDEATSALDTETEAAIQKALQELSEGRTTLVIAHRLATIKDADRIVVV
TNNGIEEQGRHQDLIEAGGLYSRLHQAQFGQMVHR
NT seq 1728 nt   +upstreamnt  +downstreamnt
gtgctgcggcaatttttttcatattataaaccatataaaacgttgttctttctcgacttt
ttctcagcgatcgcgggaggtttaatggagctgagttttcctttgatcgtcaattatttt
attgataccttgctgccgggcagggactggggactgatcatcgcgacctcaatcgggtta
tttgcggtgtacgcgctcagctcggctcttcagtatatcgtgacctactggggacacatg
cttggtatcaatattgagactgatatgagaaagtcgctttttgaccatttgcaaaagctc
tcgttcaaattttacgacaacaacaagacgggaacgctgatgtcgaagctcacgaacgat
ttaatgtatatcggtgaagtcgcccatcacggaccggaagacttattcattgcggtcatg
accattctcggggcgttcggagtgatgctgtttattaactggcagcttgctttattaacg
tttatcattatgccgatcgtcatttggctagcgctttatttcaacaaaaaaatgaccaaa
gcatttaccacgctgaacaaggatatcggagacttcagcgcgcgtgtagaaaataacatc
ggcggcatccggcttgtgcaggcgttcggaaatgaagcatttgaaaaagaacgcttcgcc
gtcaacaaccagcgttttcgtgtcacaaagctttcttcctacaaaatcatggcgaaaaac
ggttcaatcagctatatgctgacccggtttgtcacgctgtttgtccttttgtgcgggacg
tggtttgtcattcgcggctccttatcgtacggggaatttgtggcgtttgtactcttgacg
aatgtgctgttcaggcctattgacaaaattaatgccattatcgaaatgtatccgaggggg
atcgcgggtttcaaaagctatatggagctcatggagacagagccggatattcaggactca
cctgattcgaaagatgtttccggcctgaagggcaatatccgctataaacatgtttcgttt
ggctatgatgaccatcacaatgtcctcaatgacatcaacctatccattcaagcgggggaa
acggtggcgttcgtcggtccgtcaggtgctgggaaatcaacgctttgcagtctgcttccg
cgtttttatgaagcatcggagggcgacattacgattgacggcatcagtataaaagacatg
acgctttcttcgttgcgcgggcagattggcgtcgtgcagcaggacgttttcttattctcg
ggcacgcttagagaaaatatcgcctacggccgactaggcgcatcagaagaagacatttgg
caagctgtgaagcaggcgcatctggaagagctcgtccataacatgcccgatgggttggat
actatgattggcgaacgcggcgtgaagctttccggcgggcaaaaacagcgtctgtcaatt
gcaaggatgttcttgaaaaatccgtcgatcttgattctcgacgaagccacctcagccctt
gatacagagacggaagcggcgatccaaaaggcgcttcaagagttgtctgaggggcgcacg
acgcttgtcatcgcccacaggctggcaacaatcaaagacgcggacagaattgtagtcgtc
acaaacaacggtattgaagaacaaggccgtcatcaagacctgatcgaagccggaggccta
tacagcaggctgcatcaagcgcaattcgggcaaatggtgcatcgatag

DBGET integrated database retrieval system