KEGG   Bacillus subtilis subsp. subtilis 168: BSU37670
Entry
BSU37670          CDS       T00010                                 

Symbol
ywfI
Name
(RefSeq) heme peroxidase
  KO
K00435  hydrogen peroxide-dependent heme synthase [EC:1.3.98.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU37670 (ywfI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.5  hydrogen peroxide-dependent heme synthase
     BSU37670 (ywfI)
SSDB
Motif
Pfam: Chlor_dismutase PhoPQ_related
Other DBs
NCBI-GeneID: 936512
NCBI-ProteinID: NP_391647
Pasteur: BG10633
BSORF: BG10633
UniProt: P39645 A0A6M3ZHI1
Position
3866611..3867360
AA seq 249 aa
MTNEAAKTLDGWYALHDFRTMDWASWKLLSSDERQSIIHEFTGLLEKWGVAQKEGKGSQT
LYSIVGQKADFMLMILRPTMEELNQIELEFNKSRLAEFTIPAYSYVSVVELSNYLASGDG
DPYENPHVRARLYPELPESKYVCFYPMDKRRSGNDNWYMLSMEERRNLMRSHGLIGRSYA
GKVKQIITGSVGFDDYEWGVTLFSDDVLQFKKLVYEMRFDEVSARYGEFGSFFVGNHLSL
DTLPQFLYV
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacgaatgaagcggcaaaaacgcttgacggctggtatgcgcttcatgatttccgcaca
atggattgggcttcctggaagcttctgtccagtgatgagcgccaatctatcatacatgaa
ttcaccgggttgcttgaaaaatggggcgtagcccaaaaagaaggaaaaggatcgcaaact
ctttacagcatcgtcggccaaaaagctgattttatgctgatgatccttcgtcctacaatg
gaagaattaaatcaaattgagcttgaattcaacaaatcaagacttgctgagttcaccatt
ccggcatactcctacgtatcagtggtagagctgagcaactacttggcaagcggtgacggc
gatccttatgaaaatccgcatgtgcgcgctcgcctttaccctgaactgccggaatctaaa
tatgtatgcttctatccaatggataaaagaagatctggcaacgacaactggtatatgctt
tcaatggaagaacgcagaaacttgatgagaagccacggtttaatcggccgcagctatgcg
ggcaaagtcaaacagatcatcaccggctctgtcggctttgacgattacgagtggggcgtt
acattatttagcgatgatgtccttcaattcaagaagctagtgtacgaaatgcgttttgac
gaagtcagcgctcgctatggcgaatttggttcattctttgtcggcaatcacctttcgctt
gatacacttcctcaattcttatatgtataa

DBGET integrated database retrieval system