KEGG   Bacillus subtilis subsp. subtilis 168: BSU38960
Entry
BSU38960          CDS       T00010                                 

Symbol
yxjG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Meth_synt_2 Thioredoxin_6 Meth_synt_1
Other DBs
NCBI-GeneID: 937457
NCBI-ProteinID: NP_391775
Pasteur: BG11156
BSORF: BG11156
UniProt: P42318 A0A6M4JQN1
Position
3999350..4000486
AA seq 378 aa
MSQQTTPAEQKSLQRKKPPFRADQVGSLLRSEPVKKARLQKAAGEMTAEQLRQIENDEII
RIVEKQKETGLNVVTDGEFRRAWWHFDFLENLDGVEPFTPEQGIQFHNVQTKARGIKVTG
DIDFSTHPMLEDYSFLHSIAGDATPKMTIPSPNMLFFRGKLEKDEYKNDYQLFQHDVSKA
YKKAIQAFYDRGCRYLQLDDTAWAVFLSEKGLKQIEAFGTTPDELRQLFAKSINDAIADR
PDDLTVTMHICRGNFQSTWTAEGGYDAAAETIFDGLNLDGLFLEYDDSRSGGFEPLRYVK
RSDLQLVLGLVTSKFGELENPDDVKRRIEEASRYVSLDQLCLSPQCGFASTEEGNKLTEE
QQWAKLRHVVEIANDVWK
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtcacaacaaacaacacccgcagaacaaaaatcacttcaaagaaaaaaaccgccgttt
cgcgcggatcaagtcggaagcctgctaagatctgagcccgtcaaaaaagcgcggctgcaa
aaagcggccggcgaaatgaccgctgagcagcttcgccaaattgaaaacgacgaaatcatc
cgcattgtggaaaaacagaaggaaaccggcctgaacgtcgtgacagacggtgaattccgc
agagcatggtggcactttgatttcctggaaaacttagatggcgttgagccgtttactcct
gagcaaggcattcaattccataacgtacagacaaaagcacgcggcattaaagtcacaggc
gatatcgacttttcaactcacccaatgcttgaagattactcatttctccatagcattgcc
ggtgacgcgacgccaaagatgacgattccaagtccgaatatgctgtttttccgcggaaaa
ctggaaaaggatgaatacaaaaacgattatcaacttttccagcacgatgtatccaaagca
tataaaaaagcgattcaagcgttttatgacagaggctgccgctacctccagcttgatgat
acagcgtgggccgttttcttatcagaaaaaggcttaaaacaaatcgaagcgttcggaaca
acgcctgacgagcttcgccagctgtttgcgaaatccattaacgacgcgattgcagaccgc
ccggatgacttgacggtaaccatgcatatttgccgcggcaacttccagtccacttggaca
gcggaaggcggctatgacgcagcagccgaaaccatttttgacggcttgaatcttgacgga
cttttcttagagtatgatgattcacgctcaggcggatttgagccgctccgttacgtaaaa
cggtctgatcttcagcttgttcttggcttagtgacatctaaattcggtgagcttgaaaat
ccggatgacgtgaaacgccgtatcgaagaagcgtcccgttatgtaagcttagaccagctt
tgcctcagccctcaatgcggattcgcttcaactgaggaaggcaacaagctgactgaagaa
cagcaatgggcgaagctccgccatgtggttgagatcgctaatgatgtttggaaataa

DBGET integrated database retrieval system