KEGG   Bacillus subtilis subsp. subtilis 168: BSU39570
Entry
BSU39570          CDS       T00010                                 

Symbol
yxeF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3255 Cupredoxin_1
Other DBs
NCBI-GeneID: 937562
NCBI-ProteinID: NP_391836
Pasteur: BG11882
BSORF: BG11882
UniProt: P54945 A0A6M4JQV8
Structure
Position
complement(4065074..4065508)
AA seq 144 aa
MVIPLRNKYGILFLIAVCIMVSGCQQQKEETPFYYGTWDEGRAPGPTDGVKSATVTFTED
EVVETEVMEGRGEVQLPFMAYKVISQSTDGSIEIQYLGPYYPLKSTLKRGENGTLIWEQN
GQRKTMTRIESKTGREEKDEKSKS
NT seq 435 nt   +upstreamnt  +downstreamnt
atggtgatccccttgagaaacaaatatggcattttgtttttaattgctgtatgcatcatg
gtatcgggctgccagcagcaaaaagaagagacgccgttttattacggaacgtgggatgag
gggcgtgcccccgggccaacggacggtgtgaaatcagcaacagtcacatttaccgaagac
gaggttgtggaaacggaagtgatggaaggaagaggagaggtacagctgccttttatggca
tacaaggtgatttcccaaagcactgacgggtctatcgagattcagtacctcggcccttat
tatccgctcaaaagcacgctgaaaagaggagaaaacgggacattgatatgggagcaaaat
ggacagagaaaaacgatgacaagaatcgaatcaaagaccggcagggaggagaaagatgag
aaatcaaaaagctga

DBGET integrated database retrieval system