KEGG   Bacillus subtilis subsp. subtilis 168: BSU39830
Entry
BSU39830          CDS       T00010                                 

Symbol
yxcA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sensor UPF0715 TMEM169 DUF2181
Other DBs
NCBI-GeneID: 937641
NCBI-ProteinID: NP_391862
Pasteur: BG11358
BSORF: BG11358
UniProt: P46332 A0A6M4JQV6
Position
complement(4091477..4091728)
AA seq 83 aa
MKVQHKKELKFYCIVTIPSAFVVLTVISFLLQEITFPVTASAFLNASWHNLLFLIPFGLF
FYPVHIWMKREFGRWNDTEKKRG
NT seq 252 nt   +upstreamnt  +downstreamnt
ttgaaggtacagcataagaaggagctcaagttttattgcatcgtgaccattccatctgca
tttgttgtgctgactgtcatctcttttttattgcaagagattacgttcccggtgactgca
agcgcatttctgaatgcttcatggcataatcttttgtttttgataccgttcggtttgttt
ttctacccggtgcatatatggatgaagcgggagtttggccgttggaatgacacagaaaaa
aagagaggatga

DBGET integrated database retrieval system