KEGG   Bos taurus (cow): 789044
Entry
789044            CDS       T01008                                 
Symbol
DNAH2
Name
(RefSeq) dynein heavy chain 2, axonemal
  KO
K10408  dynein axonemal heavy chain
Organism
bta  Bos taurus (cow)
Pathway
bta05014  Amyotrophic lateral sclerosis
bta05016  Huntington disease
bta05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:bta00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    789044 (DNAH2)
   05016 Huntington disease
    789044 (DNAH2)
   05022 Pathways of neurodegeneration - multiple diseases
    789044 (DNAH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:bta03037]
    789044 (DNAH2)
   04812 Cytoskeleton proteins [BR:bta04812]
    789044 (DNAH2)
Cilium and associated proteins [BR:bta03037]
 Motile cilia and associated proteins
  Dynein arm
   789044 (DNAH2)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     789044 (DNAH2)
SSDB
Motif
Pfam: AAA_6 DHC_N2 DHC_N1 AAA_8 Dynein_C AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 Dynein_AAA_lid AAA_lid_1 AAA AAA_22 AAA_16 TsaE Mg_chelatase Sigma54_activat AAA_33 NB-ARC Sigma54_activ_2 T2SSE DUF3452 DUF815 DUF4743 Guanylate_kin ATP_bind_1
Other DBs
NCBI-GeneID: 789044
NCBI-ProteinID: NP_001178178
BGD-bta: BT29160
Ensembl: ENSBTAG00000008605
VGNC: 28125
UniProt: F1MK55
Position
19:27414960..27523443
AA seq 4424 aa
MSSKADKKRKVTSRGSARRRAAQSTLDAQVEEITLPASSEVQAEPETVKEEPEPVLEQPE
IQKEELEEREVDVKPLFLSRAVLTGLADATWTEEHSTVLEHFAQDPSEPILTIFIDPCMG
LKLDLGMPVQTQNQIVYFIRQAPVPITPENFEETVQFGTVRGAYIPALLRLLSGVFAPQI
FKNTTWPESIRNHFASHLHRFLACLTDTRYKLEGHTVLYIPTEAMNMKPEVVVKDKELVQ
RLETSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWRNRCMDLSGISKQLVKPGVKHI
ESILRLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMRPKDISSKLPR
LISLIRIIWVNSPHYNTRERLTSLFRKVCDCQYHFARWEDGKQGPLPCFFGAQGPQITRN
LLEIEDIFHKNLHVLRAVRGGILDVKNTSWHEDYNRFRAGVKDLEVMTQNLITSAFELVR
DVEHGVLLLDTFHRLSAREAIKRTYDKKAVDLYMLFNSELALVNRELNKKWPYLEPYMAQ
YSGQAHWVRILRRRIDRVMNCLSNAHFLPHIGTGEESVHTYQQMVQAIDELVRKTFQDWT
ATLDKDCIRRLDTPLLRISQEKAGMLDVNFDKTLSILFVEIDYWERLLFETPHYVVNVAE
RAEDLRILQENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLHWALKGAS
AFFITECRIHASKVQTIVNEFKASTLTIGWRAQEISETLLVRISGKRVYRDLEFEEDQRE
HRAAMQQKLMSLHQDVVAIMTNSYEVFKNDGPEIQQQWMLYTIRLDRMMEDALRLNVKWS
LLELSKAINGDGKTTPNPLFRVLVILKNDLQGGVAQVEFSPTLQTLASVVNDIGSHLFST
ISVFRHLPEILIKRKFQREPIHTIVERDEDIKKIQAQISSGMTNNASLLQNYLKTWDMYR
EIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLNIQFVLLDCSHLKFS
LVQHCNEWQNKFTTLLKEMAARRLLELHTYLEENSEKISRPPQTLEELGVSLQLMETLQH
ELPTMETQIPPIHEQFAILEKYEVPVQDDVLEMLDSLGGEWVAFQQTLLDSEQMLKKHKE
KFKTGLIHSADDFKKKAHNLLEEFEGKGPFTSNVGHQAALEQIAHVRAMLNAMREEENLL
RANLGIFKIEQPASKDLQNLEKELDALQQVWEITRDWEENWNQWKVGRFLTLQTEAMETM
AHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEV
QREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIELALQNIAKTWDVIQLDIV
PYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMV
LTVQRQWMYLENIFLGEDIRKQLPNESGLFDQVNGNWKAIMDRVNKDPNALRSTHYPGLL
DTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCF
DNIKLLRMQKVGGPGSKWEALGMFSGDGEYIDFLHPVLLEGPVESWLGDVERTMRVTLRD
LLRNCRLALKKFLNKRDKWVKEWAGQMVITASQIQWTADVTKCLLTAKERADKKILKVMK
KKQVSILNKYSEAIRGNLTKIMRLKIVALVTIEVHARDVLEKLYKSGLMDVSSFDWLSQL
RFYWEKDLDDCMIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKG
PAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINVE
VLSVVAQQILSILSALAAGLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPDNLKSMF
RPIAMVVPDSTLIAEIILFGEGFGNCKVLAKKVYTLYSLAVQQLSRQDHYDFGLRALTSL
LRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPSIELPVIDYGK
LRETIEQEIRDMGLQPTPFTLTKVIQLYETKNSRHSTMIVGCTGSGKTASWRILQSSLSS
LCRAGEPNFNIVREFPLNPKALSLGELYGEYDLNTNEWTDGVLSSVMRTACADEKPDEKW
ILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCG
MVYTDYTDLGWKPYVQSWLDKRPKVEAEPLQRMFEKFINKMLTFKKDNCNELVPLPEYSG
IISLCKLYSALATPENGVNPADSENFASMVELTFVFSMIWSVCASVDEEGRKKIDSYLRE
IEGTFPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNSPFYKIVVPTVDTVRYNYLVS
TMVASQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLTVNMSAQTTSNNVQSIIESRVE
KRTKGVYVPFGGKSMITFMDDLNMPAKDTFGSQPPLELIRLWIDYGFWYDRTKQTIKYIR
DMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKP
IGNVVTEATLDVYSTVAQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKSSITRL
WIHECFRVFSDRLVDTADMEAFVSILSDKLGSFFDLTFHNLCPNKRSPIFGDFLREPKVY
EDLTDLTVLKTAMETALNEYNLSPAVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGI
GGSGRQSLARLASSICEYITFQIEVTKHYRRQEFREDIKRLYRQAGVELNATSFLFVDTQ
IADESFLEDINNILSSGEVPNLYKADEFEEIQTLIIDQARAEQVPESSDSLFTYLIERVR
NNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYLMGADLGTQE
NIHKKVAQIFVTMHWSVATYSQKMLLELRRHNYVTPTNYLELVSGYKKLLAEKRQELLDQ
ANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAV
TANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQV
EMVLQAVMILRGNDPTWAEAKRQLGEQNFIKSLIHFDKDNISDKVLKKIGAYCAQPDFQP
DIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNTALAQLQEKQAALAEAQEKLRE
VAEKLEMLKKQYDEKLAQKEELRKRSEEMEMKLERAGMLVSGLAGEKARWEETVKGLEED
LGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIRKISELQVPCSPRFTFDNFLSNPTK
VRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGNQGLQIIDLQMND
YLRILENAIQFGYPVLLQNVQEYLDPTLNPVLNKSVARIGGRLLMRIGDKEVEYNPNFRF
YITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAA
GKRKLKELEDEILRLLNEATGSLLDDVQLVNTLRTSKITATEVTEQLETSETTEINIDLA
REAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLN
EYHTYAVYRYTCRTLFERHKLLFSFQMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMD
NPCTTWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWNLWYTNATPEKAMLPGEWENAC
NEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKLVMEDSAPRTPLVFILSP
GVDPTSALLQLAEHTGMAQRFHALSLGQGQAPIAARLLREGVVQGHWVFLANCHLSLSWM
PNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQL
MTEPQFSRCSKPTKYKKLLFALCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSL
YLDEYEETPWDALKYLISGVNYGGHVTDDWDRRLLTTYINDYFCDQALLTPSYRLSVLET
YFIPKDGSLASYKEYISMLPGMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPT
RAGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLAMDPSPLNVVLLQEIQRYNKLMETI
LFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLASWTRDLAMRVEQ
FEMWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNISVDSLSWEFIVSTVDDSNLVY
PPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPTESRKKSAKGMYSCPC
YYYPNRAGSSDRASFVIGIDLRSGTMTSDHWIKRGTALLMSLDN
NT seq 13275 nt   +upstreamnt  +downstreamnt
atgtccagcaaagctgacaaaaagcggaaagtgactagccggggaagtgcccgccggcga
gctgcccagtctactctggatgcacaggtcgaggagatcaccttgccggccagcagcgag
gtccaggcggagccggagaccgtcaaggaggagcctgagccagtattggaacaacctgaa
atacagaaagaagaattagaggagcgtgaggtagatgtgaagcccctcttcctgtcccgg
gctgtactgacaggactggcggacgccacatggacagaggagcacagcactgttctggaa
cactttgcccaggacccttcggaacccatcctcaccatcttcatcgacccttgtatgggg
ctgaagctagacctgggaatgcctgtgcagacccagaaccagattgtctactttattcgc
caagccccggtccccatcactccagagaactttgaggagacggtgcagtttgggacagtg
cggggtgcctacatcccagccctgcttcggctgctcagtggcgtctttgctcctcagatc
tttaaaaacacaacctggcctgagagcattcgaaatcattttgcttctcacctgcacagg
ttcttggcctgcctgacagacactcggtataagctggaggggcacaccgtcctctacatc
cccacagaagccatgaacatgaagcctgaggtcgtggttaaagacaaagagctggtgcag
cgactagagacctccatgatccactggacacggcagataaaggaggtgctcagtgcccag
gaatcagtggagacaggagaaaacttaggtcctttggaggagattgagttttggcgcaac
cgatgcatggacctgtctggcatcagcaaacagctggtgaagccaggagtgaagcacatc
gagtccatcctgcgtctcgccaagtcatcctatctggcgcccttcatgaagctggcccag
cagatccaggatggctctcgtcaagcacagtcaaacctgactttcttgtcgatcctgaag
gagccttaccaggaactggcattcatgaggccaaaggacatctctagtaaactcccgagg
ctgatcagcctcatccgtatcatctgggtcaactctccccactacaatactcgggagaga
ctgacctccctcttccggaaggtatgtgactgtcagtaccattttgcccgctgggaagat
ggaaagcaaggtcccctcccctgcttcttcggtgcccaggggccccagataacacggaac
ttgctggagattgaggacatctttcacaaaaacctgcacgtgctgcgagccgtccgcggg
ggcatcctggatgtcaagaacacctcttggcatgaagactacaataggttccgggctgga
gtcaaggacctggaggtgatgactcagaacttgatcacctcggccttcgagttagtccgt
gacgtggagcatggggtgctgctgctggataccttccatcggctctcggcccgagaggcc
atcaagcgaacatatgacaagaaggccgtggacctctacatgctgttcaatagtgagctt
gcactcgtaaaccgtgagctgaacaagaagtggccctacctggagccctacatggctcag
tactcagggcaggcccactgggtgcgcatcctacggcgtcgcatcgacagagtcatgaac
tgtctttctaatgctcatttcctgccccacatcgggaccggagaggagagtgtgcacacc
taccagcagatggttcaggccattgatgaattggtgcgaaaaaccttccaagactggaca
gccacactggacaaggactgcattcggcggctggacacgccattgctacgaatcagccag
gagaaggcgggcatgctggacgtgaactttgacaagaccctgtcgatcctctttgtggag
atcgactactgggagcggttactgttcgagacaccccattacgtggtgaatgtggctgaa
cgtgccgaggacctgcgcattcttcaagaaaacctgctgctcgtcgctcgggactataac
aggatcattgccatgctgtccccagatgagcaggccctgttcaaagaacgtatccggttc
ctggataagaagatccaccctgggctcaagaagctgcactgggccttgaagggggccagt
gcttttttcatcacagagtgccgcatacatgccagcaaggtgcagacgatcgtgaatgag
ttcaaggcgtccactctgaccatcggctggcgagcccaagagatatcagagacactgctg
gtgcgcatcagcggcaaacgggtgtacagggacctggaatttgaggaggaccaaagagag
catagggcagccatgcaacagaaattgatgagcctgcatcaggatgtggtggccatcatg
accaactcctatgaagtcttcaagaatgacggccccgagattcagcagcagtggatgctg
tacacgattcggctggaccgcatgatggaggatgccttgaggctgaacgtgaagtggtct
ctgttggaactgtccaaggccatcaatggggatggcaagactacccccaacccactcttc
cgagtgcttgtcattttgaagaatgatcttcagggaggtgtggcccaggtggagttctca
cccactctgcagaccttggcaagtgtggtcaatgacatcggcagccacctcttctccacc
atctccgtcttccgccacctccccgaaattctcatcaagcgcaagtttcagcgtgagccc
atccacaccatcgtggagcgggatgaggacatcaagaagatccaggcccagatcagcagt
ggcatgaccaacaatgcaagcctgctgcagaactacctcaagacctgggacatgtaccgc
gagatctgggagatcaacaaggactccttcatccgccgataccagcgcctcaacccgcct
gtctcttcctttgatgctgacattgcccgctacacagaggtggctaataatgtgcagaag
gaggagacggtcctgaacatccagtttgtgctcctggactgctcgcacctcaagttctct
ctggtgcagcactgcaacgagtggcagaacaaattcacgaccctgctcaaggagatggcg
gccaggcggcttctggagctgcacacctacctggaggagaactcggagaaaatcagccgc
cctccccagaccctggaggaactgggggtcagtttgcaacttatggagaccctgcagcac
gaactgcccaccatggaaacccagatccctcccattcacgagcaatttgccatccttgag
aagtacgaagtgccagtccaggacgatgtgctggaaatgctggacagtctcggtggggaa
tgggttgccttccagcaaacactgctggacagtgaacagatgctgaagaaacacaaggag
aagttcaagacaggcctcattcactcagctgacgacttcaagaagaaagcacacaatctt
ctggaagaatttgaaggcaaaggccccttcaccagcaatgtgggacaccaggcagccctg
gagcagattgcccacgtgcgggccatgctgaacgccatgcgggaggaagaaaacctcctc
cgtgccaacctgggcatcttcaagattgagcagccagcctccaaggacctgcagaacctg
gagaaggagctggacgcgctgcagcaagtctgggaaatcacccgagactgggaggaaaac
tggaaccagtggaaggtgggccggttcctgaccctgcagacagaggccatggagactatg
gcccatgggctgtttcgccgcctcactagactggccaaagagtacaaggaccgaaactgg
gaaattattgaaaccactcgctccaaaatagagcagttcaagaggaccatgccgctcatc
tcggacctgcgaaaccctgcccttcgagagcggcactgggatcaggtcagggatgaggtc
caacgtgagtttgatcaggaatcagaaagcttcaccttggagcagatcgtggagcttggg
atggatcagcatgtagagaaaattggggagatctctgcctcagccaccaaagagctggct
atagaactggcgttacagaacattgccaagacctgggatgtgattcagcttgacatagtg
ccctacaaggataagggccatcaccgactcagagggacagaagaagtattccaggccctg
gaagataaccaggtggctctgtctaccatgaaggcatctcgctttgtcaaggcctttgag
aaagatgtggaccactgggagcgctgcctctccctcatcttggaagtgattgagatggtg
ctcacagtgcagcgtcagtggatgtacctcgagaacatcttcctgggagaggacatccgg
aagcagctgcccaatgaatcaggcttattcgaccaagtcaatggcaactggaaggccatt
atggaccgggtgaacaaggaccccaatgctctccggagcacccactatccaggcctcctg
gacacgttgatagaaatgaacacaatccttgaagacatccagaagtccctggatatgtat
ttagagaccaagcgccatattttcccccgcttctacttcttgtccaatgatgacctcctg
gagattctgggccagtcccgcaatccggaggctgtgcagccacacctcaaaaaatgcttt
gacaatattaaactgctgagaatgcagaaggttgggggacccggcagcaaatgggaagcg
ttgggaatgttctcgggtgacggtgaatacatcgatttcctccacccagtgcttctggaa
gggcctgtggagtcctggcttggcgatgtggagcggaccatgagggtgaccctccgggac
cttctccggaactgtcgcctggccctcaagaaatttctcaacaagagggacaagtgggtg
aaggagtgggctggccagatggtgatcaccgccagtcagatccagtggacagccgacgtt
accaagtgcctgctgacagctaaggagcgggcagacaagaagatcctcaaggtcatgaag
aaaaagcaggtgtcaatactgaataagtactctgaggccatcagggggaacctgaccaag
atcatgcgccttaaaattgtggccctggtgactatagaagtccacgcccgggatgtgcta
gagaagctttataagagtggcctcatggatgtcagctccttcgactggctcagccaactg
cgcttctactgggagaaggatctcgatgactgtatgatccgtcagaccaacacacagttc
cagtatggttatgagtacctgggtaactctggccggctcgtcatcacccccctaaccgac
aggtgttacatgacactgaccacggccctgcacctgcatcgaggtggatcccccaaaggt
cctgcgggcacagggaagactgagacggtcaaggacctgggcaaggccctcggcatatac
gttatcgtggtcaactgctccgagggcctggactataagtccatgggccggatgtactca
ggcctggctcagacgggtgcctggggctgctttgatgaatttaaccgcatcaatgtggag
gtgctgtcggtggtggcccagcagatcctgtccatcctctctgccctggctgccggcctc
acccgcttctatttcgagggctttgaaatcaatctggtgtggtcctgtgggatcttcatc
accatgaaccctggctatgctgggcgcacagagcttcctgacaatcttaaatccatgttc
cggccaattgccatggtagtgcccgactctacacttattgcagaaatcattctttttggg
gaaggctttggcaactgcaaggttctggccaagaaggtgtacacgctttactcgctggct
gtgcagcagctctccagacaagaccactatgacttcggcctgcgtgccctcacttccctc
ctgcgctatgctggcaaaaagcgccgcctgcagcccgacctgtctgatgaagaggttctg
ctgctctcaatgagagatatgaatattgccaagctgacttccgtcgacgtgcccctcttc
aatgccatcgtgcaagatctgttccccagcatcgagctgccagtcattgactacggcaag
ctgcgggagaccattgagcaggagattcgggacatgggcctgcagcccaccccgttcacc
ctcaccaaggtcatccagttgtatgaaaccaagaattcccgccactccaccatgatcgtg
ggctgcacaggcagcggcaagactgcctcgtggcggattctccagtcctccttgtcctcc
ctgtgccgtgccggggagcccaacttcaacattgtcagggagttccctttgaaccctaag
gcactgtccctaggggagctgtatggggaatatgacctcaacacaaatgaatggacggat
ggcgtcctgtccagtgtcatgaggacggcatgtgcagacgagaaaccagatgagaagtgg
atccttttcgatggccctgtggacactctatggattgagagcatgaactccgtcatggat
gataacaaagtgctgaccctcatcaacggagagcgcatcgcaatgcctgagcaggtgtct
ctcctgttcgaagtggagaacttggcagtggcctccccagccactgtgtctcgttgcggg
atggtgtacactgattacacagacctaggctggaagccctacgttcagtcatggctggac
aagaggccaaaggtggaggctgagccccttcagcgcatgttcgaaaagttcatcaacaag
atgctgaccttcaagaaggacaactgcaatgagctggtgcccctcccagaatatagcggc
atcatctccctctgcaagctgtactccgccctggccactccggagaatggggtgaaccca
gctgacagtgagaacttcgcctccatggtagagctgacgtttgtgttcagcatgatctgg
tcggtgtgtgcctctgtggatgaggagggccgcaagaagatcgacagttacctccgcgag
atcgagggcacttttcccaacaaggacacagtgtacgagtatttcgtggacccaaagatc
cggagctggacatcgtttgaggataagctccctaagagttggcgctaccctccaaactcc
cccttctataagatcgtggtgcccaccgtcgacactgtccgctacaactacctggtgagc
accatggtggccagccagaaccccgtcctgctggtgggtcctgtggggactggaaagacc
tccattgcccagagtgtcctgcagtccttgccctccagccagtggtcagtgctcacagtc
aacatgtctgcgcagaccacgtctaataatgtgcagagcatcattgagagcagggtggag
aagcgaaccaagggtgtctatgtgcctttcggaggcaaaagcatgatcaccttcatggat
gacctcaatatgccagccaaggacacgtttgggtcccagcccccgctggagctgattcgc
ctctggattgactatggcttctggtatgatcgaacgaagcagaccatcaagtacattcga
gacatgttcctgatggctgccatgggccctcctgggggtggacggaccgtcatctcccca
aggctgcagagtcgatttaatatcatcaacatgaccttccccacggagtcccagatcatc
cggatattcggcaccatgatcaaccagaagctccaggactttgaggaagaggtgaagccc
attgggaacgtggtgaccgaggccaccttggacgtgtacagcactgtggcgcagcgcttc
ctgcccacccccgccaagatccactacctcttcaaccttcgagacatctccaaggtgttc
cagggcatgctgagggccaacaaggacttccacgataccaagtccagcatcacccgactt
tggatccatgaatgcttcagagtcttttctgaccgactggttgacaccgcagacatggaa
gccttcgtgagcatcctaagtgacaaactcggctccttctttgacctgacgtttcataac
ctttgtcccaacaaacgttctcccatctttggggacttcctgcgggagcccaaggtgtac
gaggacctgacggatctgacggtcctgaagacagccatggagacggcactcaacgagtac
aacctgtcacccgctgtcgtgccaatgcagctggtgctcttccgagaggccatcgaacac
atcacacggatcgtgcgggtcattggacagcctcggggcaacatgcttttggtgggcatt
gggggcagcgggcggcagagtctggcccgcctggcctcatccatctgcgagtacatcacc
ttccagattgaggtcaccaaacattatcggaggcaggaattccgagaagatatcaagcgt
ctgtatcgccaggctggggtggagctcaacgccacgtccttccttttcgtggacacccag
attgctgacgaatcattcctagaggacatcaacaacatccttagctcgggcgaggtcccc
aatctctataaggcggatgaattcgaggagatccagacgctcatcatagaccaggcgcgc
gctgagcaggtgccggagtcctcggacagcctcttcacctacctcatcgagcgcgtgcgg
aacaacctgcacatcgtcctctgcctcagccccgtgggcgaccccttcaggaactggatc
cgccaatacccagccttggtgaactgcacaaccattaactggttctcagagtggccacgc
gaggccctgctggaggtggctgagaagtacctgatgggagccgatctggggacccaggaa
aatatccacaagaaagtggcccagatcttcgtcaccatgcactggtcagtggccacatat
tcccagaagatgctgttggaactccgaagacacaactatgtcacgcccactaactacctg
gaacttgtgtctggatataaaaagttgctggcggagaagcggcaggagctgctggaccag
gccaataagctgcggacagggctgtttaagattgatgaaactagggaaaaggtggaagtg
atgtccttagagctggaggatgccaagaaaaaggtggctgagttccagaagcagtgcgag
gagtacctggtcatcattgtgcagcagaagcgggaagcggatgagcagcagaaggctgtc
acagccaatagcgagaagattgcgattgaggaagtcaagtgccaggcactggctgacaat
gcccagaaggatttggaagaggcattaccagccctggaagaggccatgcgggccctggag
tctctgaacaagaaggacataggagagatcaagtcttacggacgccccccggcccaggtg
gagatggtgttgcaggcagtcatgatccttcgaggcaatgatcccacctgggcagaggcc
aagaggcagctaggggaacagaacttcatcaaatcactgatccacttcgataaagacaat
atctcagacaaggtcctgaagaagatcggagcctactgtgcccagcccgatttccagcct
gacatcatcggccgtgtgtcactggctgccaagtccctatgcatgtgggttcgggccatg
gagctctacgggcggctgtaccgggtggtggagcccaagcggatccgcatgaacaccgca
ttggcccagcttcaggagaagcaggcggccctggccgaggctcaggagaagctgcgtgag
gtggctgagaaactggagatgctgaagaaacagtatgatgagaagctggcacagaaggag
gagcttcgcaagaggtctgaggagatggagatgaagctggagcgtgctgggatgctggtg
tccgggctggctggcgagaaggcccgatgggaggagacagtaaagggcctggaggaggat
ctgggctacctggtgggagactgtctcctggcagctgccttcctgtcctatatggggccc
ttcctgaccaactaccgggatgagatagtcaaccaaatctggatcaggaagatttcagag
ctgcaggttccttgctcaccccgcttcacattcgacaacttcctgtccaatcctaccaaa
gttcgggactggaacattcaagggctgccctcggatgccttctccactgagaacggcatc
attgtcacccgcggcaacaggtgggcactgatgatcgatccgcaggcccaggctctgaaa
tggatcaagaacatggaaggaaatcagggcctacagatcatcgacctgcagatgaacgat
tatctccgaatcctagaaaacgccatccagtttggatatccagttctgctccagaatgtg
caggaatatctggatcccacactcaaccctgtgctcaacaaatctgtagctcgaattggt
ggtcggttactgatgcgcattggagataaggaggtggaatacaatcccaacttccgtttc
tacatcaccaccaagctctccaacccccactacagcccagagacctcagccaagaccacc
attgtcaacttcgctgtcaaagaacagggcctggaggcccagctgctgggcattgtggtc
cggaaggagcggccggagctggaggagcagaaggactccctggtcatcaatatcgccgct
ggcaaaaggaagctcaaggagctggaggacgagatccttcggctgctgaacgaggccacg
ggctccttgctagacgacgtgcagctggtgaacaccctgcggacctccaagataaccgcc
actgaggtgaccgaacagctagagaccagcgaaaccacggagatcaacatcgacctggcc
cgagaggcttaccgcccctgcgcccagcgggcctctgtgctgttcttcgtgctcaacgat
atgggccgcatcgacccgatgtaccagttctccctggacgcctacatcagcctctttatc
ctcagcatcgacaagagccatcgcagcaacaagctggaggaccgcatcgactacctgaac
gagtaccacacctacgctgtctacaggtacacctgccgcacgcttttcgagcgccacaag
ctgctattcagttttcagatgtgtgccaaaattctggagacttctgggaaactcaacatg
gatgaatacaacttctttctacgcgggggcgtggtcttggatcgtgagggccaaatggat
aacccttgtaccacctggctcgcagacgcctactgggataacatcacagagctggacaaa
ctgaccaacttccatgggctcatgaactcctttgagcagtatcctcgggactggaacctg
tggtataccaacgccacccccgagaaggccatgctgccaggtgagtgggaaaatgcctgc
aatgaaatgcaacgaatgctgattgttcgctccctgcgccaggaccgtgtggccttctgt
gtaacttcttttatcgtctccaaccttggctcccgcttcattgagccgcctgtgctaaac
atgaagttggtgatggaggactcggccccacggaccccactggtgttcatcctttccccc
ggcgtggaccccaccagtgccttgctccagctggctgagcatacaggcatggcccagcgc
ttccacgctctgtctctgggccagggccaggcccccatcgcggctcggctcctccgagag
ggtgtggttcagggacactgggtattcctcgccaactgccacctgtcgctgtcctggatg
ccaaacctggataaactggtggagcagctgcaggtggaggatccgcacccttctttccgc
ctctggctcagctccagcccccacccagacttccccatctccatcttgcaggccagcatc
aagatgaccacagagccaccaaagggcctaaaggccaacatgactcgtctttaccaactg
atgacagaaccacagttttcccgctgctccaagcccaccaagtataagaaactgctgttc
gcactgtgcttctttcactctgtgttacttgaacgcaaaaagttcctgcaacttggctgg
aacatcatctacggcttcaatgactctgactttgaggtgtcagagaacttgctgagcctc
tacctggacgagtatgaggagacgccctgggatgcactcaagtacctcatctccggggtc
aactatggtggacacgtcacggatgactgggaccggcgcctgctgaccacctacatcaat
gactatttctgtgaccaggctctcttgaccccctcctaccggttgtcagtgttggagacc
tattttatccccaaggatgggagcctggcctcgtacaaagagtacatcagcatgttgcct
ggcatggaccccccagaggcttttggccagcaccccaatgccgatgtggcctcccagatc
acagaggcacgcactctgtttgagactctgctttccctgcaaccccagattacacccacc
agggccggaggccagagtcgggaggagaaggtccttgaattggctgccgatgtgaaacag
aagatcccggaaatgatcgactatgaggggacccgaaaactactggctatggacccctcc
ccactcaatgtggtccttttgcaggagattcagagatacaacaagctgatggagaccatc
ctcttctcactgacagacctagaaaaaggcatccagggcctcatcgtcatgtctaccagc
ctggaagagattttcaattgcatttttgatgcccatgtccctccgctctggggaaaggcc
tacccctcacagaagccattggcttcatggacccgggacttggccatgcgtgtggagcag
tttgagatgtgggccagccgtgcacggcctcctgtgatcttctggctgtctggcttcacc
tttcccactggcttcctcactgccgtgctgcagtcttcagctcgccaaaacaatatttca
gtggacagcctctcttgggagtttattgtttccactgtggatgacagcaacctagtgtat
ccacccaaggatggtgtctgggttcggggtctatacctggagggtgcgggctgggaccgg
aagaactcctgcttggtggaggcagaacccatgcagcttgtctgcctcatgcccaccatc
cacttccggcctactgagagccgcaagaagagtgccaagggcatgtattcctgtccctgc
tattactatcccaaccgggcaggcagctcagaccgtgcatccttcgttattggcatcgac
ctccgctctgggaccatgacctctgatcactggatcaagagaggcactgctctactcatg
agcctggataactga

DBGET integrated database retrieval system