KEGG   Burkholderia vietnamiensis G4: Bcep1808_7111
Entry
Bcep1808_7111     CDS       T00493                                 
Name
(GenBank) type II secretion system protein E
  KO
K02283  pilus assembly protein CpaF [EC:7.4.2.8]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcep1808_7111
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_7111
   02035 Bacterial motility proteins [BR:bvi02035]
    Bcep1808_7111
Enzymes [BR:bvi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bcep1808_7111
Secretion system [BR:bvi02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Bcep1808_7111
Bacterial motility proteins [BR:bvi02035]
 Pilus system
  Pilus assembly proteins
   Bcep1808_7111
SSDB
Motif
Pfam: T2SSE FtsK_SpoIIIE Dynamin_N Zeta_toxin AAA_29 TsaE AAA_16 ABC_tran Septin AAA_7
Other DBs
NCBI-ProteinID: ABO59994
UniProt: A4JUP1
Position
pBVIE02:75925..76971
AA seq 348 aa
MSEIAENPLLKVARLEENAVQLFFESLKLIKPYLESSTVAEVMINSANNIWVEERGEMRR
LDIEFNPSTLTGAIHSLAASVEKSALAGTAQGIINGGHKNLRIATVMKPTAIDGDALAIR
RHRETNLSINDYAKMGAFSLVHAKRSVDRPIFPPGVADEALAEAFTAMVQQRANVLVAGG
TSAGKTTFLNSLNGLIPREERVITIEDTMELKVDLPNRVRLLSNPDKGVTTQILVALCLR
FRPDRIIVGEVRGGEAYDFIQALSTGHDGGMGSIHSNDARGGLTRLESLAMLGIPPGSRW
ELADMRKAIAECFHYVIHLRRTGELRHVSEVLAIKGFKDGDYVLERVF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtctgaaattgccgaaaatcccttgctgaaggtcgcacggctcgaagagaacgctgta
cagctgttcttcgagtcgctgaagctcatcaagccctacctcgaatcctcgaccgtagcc
gaagtcatgatcaattcggcgaacaacatctgggtcgaggagcggggcgagatgcgccgg
ctcgatatcgagttcaatccgtcgacactgacaggggccattcactcgctcgcggcctct
gttgaaaagtcggcgctcgcgggcacggcccaagggattatcaacggcggccacaagaac
ctccggattgcgacggtcatgaagccgaccgcgattgacggcgacgcgctcgcgatccgt
cggcaccgcgagaccaatctgtcgatcaacgattacgcgaagatgggcgcgttctctttg
gtccatgcaaagcgaagcgtcgatcgaccgatcttcccacccggcgtcgctgacgaagcg
ctcgccgaggcgttcaccgcgatggttcaacagcgcgccaacgtgctcgttgctggcggt
acctccgcgggcaagacgacgttcctgaactcgctgaacggcttgataccacgcgaggag
cgagtcatcacgatcgaggacacgatggagctaaaggtcgaccttccaaaccgtgtccgg
ttgctgtcgaaccctgacaaaggtgtgacgacgcagatcttggtggcgctgtgcctgcga
ttccggcccgaccgaatcatcgtgggtgaagttcgtggcggcgaagcatatgacttcatc
caggcgctgagcaccggccacgacggcggaatgggttcgattcactccaatgatgcgcgc
ggcggactgacccgccttgagagcctcgcgatgttgggcatcccgccaggcagccgctgg
gaactcgccgacatgcgcaaagcaatcgccgagtgcttccactacgtcatccacctgcga
cgcacgggcgaactgcgtcacgtgtccgaggtgctggcaatcaaagggttcaaagacggg
gactacgtccttgaacgcgttttctaa

DBGET integrated database retrieval system