KEGG   Bacteroides vulgatus: BVU_2887Help
Entry
BVU_2887          CDS       T00546                                 

Definition
(GenBank) putative iron transport, fusion membrane protein
  KO
K04759  ferrous iron transport protein B
Organism
bvu  Bacteroides vulgatus
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvu02000]
    BVU_2887
Transporters [BR:bvu02000]
 Other Transporters
  Others
   BVU_2887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N Gate FeoB_C FeoA MMR_HSR1 SRPRB TMEM169
Motif
Other DBs
NCBI-ProteinID: ABR40526
UniProt: A6L4B2
Position
complement(3650058..3652526)
Genome map
AA seq 822 aa AA seqDB search
MRLSELRTGEKGVIVKVLGHGGFRKRIVEMGFIKGKTVEVILNAPLKDPIKYRLLGYEIS
LRRQEADMIEVVSEQEARTMQNPYHGSITEDVPVSESELVALAKGKRRTINVALVGNPNC
GKTSLFNIASGAHEHVGNYSGVTVDAKEGFFDFQGYHFRIVDLPGTYSLSAYTPEELYVR
KHIIEETPDVIINVADSSNLERNFYLTTQLIDMNVRMVIALNMYDELESSGNKLDYIKLS
QLIGVPMIPTVCRRGEGIDQLFHVIIGIYEGGDFLSQKGEIRSEILEDLRDWHKTYVPDH
EFGSHKEEEDARPRGYMRHIHINHGPELERSIEEVKKAISQNEDIRHKYSTRFLSIKLLE
NDKEIENFISTLPNGKEIIAIRNKETLRIRKVMNEDSEQAITDAKYGFITGALKETFTDN
HLEKEQTTRVIDSIVTHRIWGYPIFFLFLYIMFEGTFVLGDYPMQGIEWLVDQLGNLIRN
NMAEGPLKDLLIDGIIGGVGGVIVFLPNILILYFFISILEDSGYMARAAFIMDKIMHRMG
LHGKSFIPLIMGFGCNVPAIMATRTIEDRKSRLITMLVNPLMSCSARLPIYLVMIGAFFP
NCASFMLLCIYTAGILLAVIMARIFSKFLVKGEDSPFVMELPPYRMPTSKSIMRHTWEKG
AQYLKKMGGIIMIASIIIWFLGYYPQHDAYESVAEQQENSYIGQIGKAIEPVIKPLGFDW
KLGIGLISGVGAKELVVSTLGVLYTNEGDVENVNLSNRIPITPLVALAYMLFVLIYFPCI
ATFAAIKQESGSWKWAIFTAGYTTGLAWLVAFTVFQIGSLIV
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttatccgaattaagaacaggagaaaaaggcgtaatagtcaaggttttaggtcac
ggtggtttccgcaagcgaatcgttgaaatgggttttattaaaggaaaaaccgtagaggta
atcttgaacgcccctttgaaagaccctataaaatacagactactaggttacgagatctct
ctccgaagacaagaggcagatatgattgaggtggtaagcgagcaggaagcacgcacgatg
caaaacccttaccatggttccataacagaagatgtacccgtgtccgaatcagaactggtg
gcactggcaaaaggcaaacgccgtacaatcaatgtagccttagtaggtaatcctaattgt
ggaaagacttcgctattcaatattgcatccggcgcccatgaacatgtaggaaactacagt
ggtgtgacagtagatgccaaagaaggttttttcgacttccaaggttatcatttccgtatt
gtagatttacccggaacctattctctttcagcctatactccggaagaactttatgtacgc
aaacatatcattgaagaaactccggatgtaatcatcaatgtggcagactcttccaacctg
gaacgtaatttctatcttaccacccaattgattgacatgaatgtgcgtatggtcatcgca
ctgaatatgtatgacgaactggaaagcagcggcaacaaactggattacatcaagttaagc
caattgatcggagtgcctatgatacctactgtctgccggcggggtgaaggcatagaccaa
ctgttccatgttatcatcggtatttacgaaggcggggatttcctgtcacaaaagggcgaa
atacgttctgaaattctggaagatctgagagactggcacaaaacctatgtacccgaccac
gaattcggaagccacaaagaagaggaagatgcccgcccacgcggatatatgcgccatatt
cacattaaccacggtcctgaactggagcgcagtatcgaagaagtaaaaaaagcaatcagt
caaaacgaagacatacgccataaatactccacccgcttcctatctatcaaattactggaa
aacgataaggaaatagaaaatttcatctctacactgcctaatggcaaagaaattatagcg
atacgcaacaaggaaaccttacgtatccgtaaagtgatgaacgaagacagcgagcaagct
attacggatgctaaatatggttttattaccggagctttgaaggaaacattcaccgacaat
catttggaaaaagaacaaacaacccgcgtgatagacagtattgtgacacatcgcatttgg
ggatatcctatttttttcctgttcctttacatcatgtttgagggaacctttgttttgggt
gactaccctatgcaaggtattgaatggctagtagaccagttgggcaacctgatacggaac
aatatggctgaaggtcctttgaaagacttactgatagatggtattatcggtggagtgggc
ggtgttatcgttttcctgccgaatatcctcatattatacttttttatttctatattggaa
gattcggggtatatggcacgcgctgcatttatcatggataaaataatgcaccggatggga
ctgcatggcaagtcctttattccactgattatgggattcggctgtaatgtacctgccata
atggcaacacgtactatagaagaccgaaagtccagactaatcaccatgttggtgaatcct
ttaatgtcctgtagtgctcgtcttcccatatatttagttatgataggtgcttttttccct
aactgcgccagctttatgttactttgcatctacacagcaggcattttattggcagtaata
atggcccgtattttcagtaaatttctggtgaaaggagaagattctccatttgtgatggaa
ctccccccctatcgtatgcctacctctaaaagtatcatgcgccatacatgggaaaaagga
gcacaatatctgaaaaagatgggaggcattatcatgattgcctcaattattatctggttt
ctagggtattatccacaacatgatgcttacgaaagcgtggctgagcaacaagaaaattca
tatatcggacaaataggcaaagccatagagcctgttatcaaaccgctaggatttgactgg
aagttaggaatcggacttatttcaggtgtgggtgctaaagaactggtagtaagcacacta
ggagtattatacacaaatgaaggagatgtggaaaatgtgaatctttctaaccgcatcccc
attactccactggttgcattagcttacatgctgtttgtattgatttacttcccctgtatt
gccactttcgcagcaatcaagcaagaatccggcagttggaaatgggccatattcacagca
ggatacaccactggattggcttggcttgttgcatttactgtatttcaaataggaagtctt
atcgtttaa

DBGET integrated database retrieval system