KEGG   Gottschalkia acidurici: Curi_c01110Help
Entry
Curi_c01110       CDS       T02255                                 

Gene name
tmk
Definition
(GenBank) thymidylate kinase Tmk
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
cad  Gottschalkia acidurici
Pathway
cad00240  Pyrimidine metabolism
cad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Curi_c01110 (tmk)
Enzymes [BR:cad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     Curi_c01110 (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 AAA_22 Cytidylate_kin CbiA dNK AAA_5 AAA_18 CLP1_P AAA_16 APS_kinase Torsin AAA_33 MeaB ParA ABC_tran KTI12 AAA_30 TIR_2 RNA_helicase AAA_29
Motif
Other DBs
NCBI-ProteinID: AFS77191
UniProt: K0AXN6
Position
111388..112032
Genome map
AA seq 214 aa AA seqDB search
MRGEQMKGLFITLEGPDGSGKSTVSRMLASYLRERGLRVTLTREPGGTDISEKIRHIILD
NKNTEIAYTTEALLYAASRAQHISEKIVPAIDDGRIIICDRFVLSSLVYQGIGRGLGIDS
VKMINDFAIQGIEPDAILFFDINPKIALKRKTRKSKGDRLEKEDISFHEKVYKGYKHLTE
IYSEKIKVIDASKSKEEVFNQVRNIVDILLNEDK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggagaacaaatgaagggcttattcataacattagagggaccagatggatctggt
aaaagtacagtgtcaagaatgttggcatcatatctaagggaaagagggcttagagtaaca
ttaaccagagaaccaggtggaacagacataagtgagaagataagacatattatattagac
aataaaaatacggaaatagcgtatacaacagaagctttattatacgcagcttctagagca
cagcatatatcggagaagatagtgccagctatagatgatggaaggataataatatgtgat
agatttgtactatcaagtttagtatatcaaggtataggaaggggtctaggaatagatagt
gtaaagatgataaatgattttgcaattcaaggcatagaaccagacgctatactctttttt
gatataaatcccaaaatagctttaaaaagaaagactagaaaatctaaaggcgatagacta
gagaaagaagatataagctttcatgagaaagtatataaaggatataaacatcttacagag
atctactcagagaaaattaaagtgatagatgcttctaaaagtaaggaagaagtatttaat
caagtaaggaatattgtcgatatattgttaaatgaagacaaataa

DBGET integrated database retrieval system