KEGG   Campylobacter iguaniorum: CIG1485E_0905Help
Entry
CIG1485E_0905     CDS       T03252                                 

Gene name
ribAB
Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
caj  Campylobacter iguaniorum
Pathway
caj00740  Riboflavin metabolism
caj00790  Folate biosynthesis
caj01100  Metabolic pathways
caj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CIG1485E_0905 (ribAB)
   00790 Folate biosynthesis
    CIG1485E_0905 (ribAB)
Enzymes [BR:caj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CIG1485E_0905 (ribAB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CIG1485E_0905 (ribAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AII14743
UniProt: A0A076FAM9
Position
complement(916743..917759)
Genome map
AA seq 338 aa AA seqDB search
MAFEKVLQAIEDIKNGKMVVMVDDEDRENEGDIVYAACFSDIEKVNFMISHAKGVLCTPV
TRELASKFELAPMVSSNTSCHETAFTVSIDAKAAATGVSAYERDMTIKMLVDYNTTADDF
VRPGHIFPLIAKNGGVLERTGHTEGSIDLCKLAGVAPVSVICEVVNDDGTMARRDDLEKF
CEKFGLNMVSVSDIIEYRLHHEKLINVSEPKQGSVAGFLATKYSIKDHLSNTHTAFVFGQ
INKKTNVKFHKIRTDIELLSSPKYPEFISHLETLKKEGGILVFLDGEDCNSNIFKNYGVG
AQIIKYFGAKDIEILSSSEYKEFVAIKGFGLNILGYKS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaaaaagttttacaagcgatagaggatataaaaaacggcaaaatggttgtc
atggtcgatgatgaagatagggaaaacgagggcgatatagtttacgctgcttgttttagt
gatattgaaaaagtaaatttcatgataagccacgcaaaaggcgtcttgtgtactccagtt
acaagagagcttgcgagcaaatttgaactagctccaatggttagctcaaatacaagctgc
cacgaaacagcttttacagtaagtatcgatgctaaggctgcagccactggcgtgagtgct
tatgagcgtgatatgactatcaaaatgctagttgattacaacacaactgctgatgatttt
gtgcgtcctggacacatttttccattgattgctaaaaatggtggcgttttggagcgaact
gggcacactgaaggaagcatagatttatgtaaacttgctggagtggcgccagtttctgtt
atttgcgaagttgtaaatgatgatggaactatggcaaggcgggatgacttagagaagttt
tgcgagaaatttggactaaatatggtaagcgtttcagatataatagaataccgtttgcac
catgaaaagcttataaatgtaagtgagccaaagcaaggtagcgtggctggatttttggct
acaaaatacagtataaaagaccacttaagcaacactcacacagcctttgtgtttgggcaa
ataaataaaaaaacaaatgttaaatttcacaaaatcagaaccgatatcgagcttcttagc
tctccaaaatatccagagttcatctctcatcttgaaacgcttaaaaaagagggtggaata
cttgtatttttagacggcgaagactgtaactcaaatatatttaaaaattatggcgttggt
gctcaaatcataaaatattttggtgcaaaagatatagaaattttaagctcaagcgaatat
aaagagtttgtggctataaagggatttggattaaatatattaggttataaatcttga

DBGET integrated database retrieval system