KEGG   Citrobacter amalonaticus Y19: F384_15820
Entry
F384_15820        CDS       T03934                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00230  Purine metabolism
cama01100  Metabolic pathways
cama01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    F384_15820
Enzymes [BR:cama01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     F384_15820
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AKE59919
UniProt: A0A0F6TWV3
Position
3438807..3441104
AA seq 765 aa
MDAREATATGESCMRVDAIAKVTGRARYTDDYMMAGMCYAKYVRSPIAHGYATSINCDEA
KSLPGVLAVFTWEDVPDIPFATAGHAWTLDENKRDTADRLLLTRHVRHHGDAVAIVVARD
ELTAEKAALLVKVEWETLPVITTPEAALAHDAVPIHPGGNLLNCSEMTTGDVQQAIDAAD
YQLQGHYQTPVIQHCHMESVTSFAWMEDDSRISIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPYVGGGFGNKQDVLEEPMAAFLTRKLGGIPVKVSLSREECFLASRTRHAFTIDGQMG
LNRDGTLKGYRLDVLSNTGAYASHGHSIASAGGNKVAYLYPRSAYAYRSTTCYTNLPSAG
AMRGYGAPQVIFAVESMLDDAATALGLDPVEVRLRNAACEGDKNPITGKRIYSAGLPECL
QKGRALFEWDARRAECQHQQGNIRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETLGVPVSDVHVISTQDTDITPFDPGAFASRQSYVAAPAL
RKAAIQLRDKILHHAADMLHQSVMSLTLTAGSIVLIDRPDSPLLSLKELAMDAFYHPERG
GQLSAECSVKTTTNPPAFGCTFVDLSVDIALCKVTVNRILNVHDSGHILNPQLAEGQVHG
GMGMGIGWSLFEEMIIDAESGLVRNPNLLDYKMPTMPDLPQLESAFVETQEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAIDTLPLTPKRLYAEFHQAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatgcgcgggaagcaaccgctaccggtgagtcatgtatgcgcgtggatgccattgct
aaagtgaccgggcgggctcgatatactgatgattacatgatggcgggcatgtgttatgcc
aagtacgttcgcagcccgattgcccatggttacgccaccagcatcaactgtgacgaagcg
aaaagcctgcccggggtgttggccgtgtttacctgggaagatgtacctgatattccattc
gccacggcaggacacgcctggacgctggatgaaaacaagcgcgacaccgccgaccgttta
ctgttgacccgtcacgtacgccatcatggcgatgcggtcgcgattgtcgtggcaagagac
gagttaaccgcggagaaagcggccctgctggtgaaggtggaatgggaaacactcccggtg
attaccacaccagaggccgccctggcgcatgatgctgtccccattcatcccggcggtaat
ctgctcaattgcagtgaaatgaccaccggggatgtgcaacaggccattgatgccgcagat
tatcaactccagggacattaccagacgccggttattcaacactgccatatggaaagcgtc
acctcatttgcctggatggaagatgactcacgtatttccatcgtctccagtacgcagatt
ccgcacattgtacggcgggttgtgggtcaggcgctggatattccctggtcatgcgtgcgg
gtgatcaaaccgtacgttggcggcggatttggcaacaagcaggatgtgctggaagagcca
atggccgcgttcctgacccgtaaactgggcggtataccggtgaaagtctcgctgagtcgc
gaagagtgttttctcgcttcccgtacccgccatgcgttcacaattgatggacagatgggg
ctcaatcgcgacggcacgttgaaaggctatcgtctggatgtcctgtcaaataccggtgct
tacgcctcgcacggacactcgatcgcctcggcgggcggcaacaaagtggcctatctctat
ccccgtagcgcgtatgcttaccgttccaccacctgctataccaatctcccttccgctggc
gcgatgcgcggctacggcgcgccgcaggtgatctttgccgtggaatcaatgctggatgac
gccgcgacggcgctgggactcgacccggtcgaggttcggttgcgtaatgcggcctgcgaa
ggcgataagaacccaattaccggcaaacgcatctacagcgcgggactcccggagtgtctg
caaaaaggtcgcgcactgtttgaatgggacgcccgtcgtgctgaatgtcagcaccagcag
ggcaatatccgccggggtgtcggcgtcgcctgctttagctacacctccaacacctggccg
gttggtgtggagatcgccggtgcccgtctgcttatgaatcaggatggcacgatcaacgtt
cagagcggcgccacggaaatcggtcagggggcggatacggtcttctcgcagatggtggcg
gaaaccctcggcgtaccggtcagcgatgtacacgttatttcgacccaggataccgatatt
accccgttcgaccccggcgcatttgcctctcgccaaagctatgtcgccgcaccggcgctg
cgcaaagcagcaatacaactgcgcgataagatccttcatcacgcggccgacatgctgcat
cagtccgtcatgagcctgacgctgacggcaggtagcatcgtccttatcgatcgcccggac
tctccattgctgtcattaaaagagctggcgatggatgccttttatcacccggaacgcggc
ggccagctgtcagcagaatgctccgtgaaaaccaccaccaatccaccggcgtttggctgc
acgtttgtcgatctgagcgttgatatcgcgctgtgcaaggtcacagtcaaccgcatcctc
aatgtccacgattccggtcatattctgaacccgcaactggcggaaggacaggtgcatggc
gggatggggatgggcattggctggtcgctgtttgaagagatgatcatcgatgcggaaagt
ggcctggtgcgaaacccgaatctcctcgattacaaaatgccaaccatgcccgacctgccg
caactggaaagcgcattcgttgaaacccaggagccacaatcagcgtatgggcataaatcc
ctcggcgagccgcctatcatcccggttgctgcagccattcgtaacgcagtgaaaatggcc
acaggcgttgcgattgatacgctgcccctgacgccaaaacggttgtatgcggagtttcac
caggctggcttgatttga

DBGET integrated database retrieval system