KEGG   Capsicum annuum: 107843117Help
Entry
107843117         CDS       T04646                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cann  Capsicum annuum
Pathway
cann03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107843117
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cann03041]
    107843117
Enzymes [BR:cann01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107843117
Spliceosome [BR:cann03041]
 Complex C
  Other components
   Step II factors
    107843117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD T2SSE AAA_30 Myosin_head AAA_19 Rhodanese ABC_tran NACHT
Motif
Other DBs
NCBI-GeneID: 107843117
NCBI-ProteinID: XP_016542781
UniProt: A0A1U8E8J6
Position
9
AA seq 711 aa AA seqDB search
MPSMAANNFSRNTQQHQSKGDFFARKQKIEQQRKNLPIAEVERRLMEEVRNNDTLIIVGE
TGSGKTTQLPQYLFKWGFCHDGGIIGITQPRRVAAITVAKRVAEESGVPLGQRVGYAIRF
EDVTSVQTKIKYMTDGLLLREALLDPYLSKYSVIIVDEAHERTIHTDVLLGLLKNVQKAR
SKSINGVVNTDHNNSNAGHDLEERIGNQNDGILKPCQAKKYNLLKLIIMSASLDARVFSE
YFGGARAVHVQGRQFPVDIFYTHKPETDCIDAALITIFQIHLEEGPGDILVFLTGQEEIE
SVERLIHERLRQLPESSRKLLTFPIFSSLPSEKQMKVFMPSPPGYRKVILATNIAETSVT
IPGIRYVVDPGLVKARTYDPKMGVDSLIIVTTSKAQALQRSGRAGRDGPGKCYRLYQESF
FEKLTDSTLPEIKRCDLSNVVLQLKALGIDDVVNFDFIEKPDRTAVVNSLWSLYLLGAVT
EENKLSDVGHQMARLPLDPVYSKALIVASQFGCLKEMLICVAMLSVESIFYAPREKLEES
RNALKSFASPEGDHLTLLNVYRAADEFFQKNKMVNSEERAEKNLRKWCKDNYINSRSLKH
ARDIHSQILRNVEQMGLRVTSCEDDMLLLRRCLAASFFLKVAMKQPDGAYRVTLSGLMVQ
IHPSSVLFRAKPECIVFNELVRTNHSYVRNVSRIDYLWLIELAPHLYAVQD
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaatggctgctaacaatttttcaagaaacactcaacaacatcaatctaaaggg
gacttttttgccaggaagcaaaagattgagcaacagaggaaaaatttaccaattgctgaa
gtcgaaaggaggctcatggaagaggtgcggaacaatgatactctgataattgttggagaa
actggaagtggaaagacaactcaactacctcagtatctttttaaatggggattttgccat
gatggtggtatcattgggataactcaacctagacgtgtggctgctatcactgttgctaaa
cgcgttgctgaggaaagtggagttccattaggtcaaagggttggatatgctattagattt
gaagatgtaacttctgtccaaacaaagatcaaatatatgacagatggtttgcttctgagg
gaagcattattggatccatacctctccaagtattctgttattattgttgatgaggcgcac
gagcgaactatccacactgatgtattgcttggattgttaaagaatgtacagaaagcaagg
tcaaaatcgataaacggagtggtaaatactgatcataataattctaatgccgggcatgac
ttggaggaaaggattggcaatcagaatgacggtattttgaagccatgtcaagcgaaaaag
tacaacctgttgaaattgatcatcatgtcagccagtttggatgcacgagttttctcagag
tactttggtggtgcaagagctgttcatgttcagggacggcagtttcctgtcgatatattc
tacactcataagcctgagacagattgcatagatgcggctttgattactatatttcagata
catctagaggagggtcctggtgatatacttgtattccttactggtcaagaagagattgaa
tccgttgagaggcttatccatgaacgcctccgacaattacctgaaagcagtaggaagctc
ttaacttttcccatattctcatcacttccctctgagaagcaaatgaaggttttcatgcct
tcaccaccgggatatcgtaaggtgattttggcaacaaatattgctgagacatctgtgaca
atacctggaattaggtacgtagttgatcctggactggtgaaagcacgaacatatgatcct
aagatgggagttgattcattgatcattgtcacaacatctaaagcgcaagctctgcaaagg
agtgggcgtgcaggacgtgatggacctgggaaatgctatcgtttgtatcaagaaagtttc
tttgagaaacttacagattctacgttacctgagattaagagatgtgacctctcgaatgtt
gtattgcagctcaaggctctaggcattgatgatgtcgttaactttgacttcattgaaaaa
ccagacaggactgctgtagtcaactcattgtggtctctctacttattgggcgctgtaaca
gaagagaataaactttcagatgttggacatcaaatggccaggctgccccttgatccagtc
tattctaaggctctaattgttgctagccagttcggctgcttgaaagaaatgttgatctgt
gttgcaatgctttcagtggaatctattttctatgcaccacgtgaaaagttggaagagtca
cggaatgcgttgaaaagttttgcaagtccagagggggatcatttgacgttgcttaacgta
taccgcgctgctgatgagttctttcagaagaacaagatggtaaatagcgaggaaagagct
gaaaagaatcttagaaaatggtgcaaggataattatattaacagtcgctctctaaaacat
gctcgtgatatccacagtcaaattctgagaaatgttgaacaaatgggactccgcgtcact
tcttgtgaagatgatatgcttctccttcgcagatgccttgccgcctcgtttttccttaaa
gtagctatgaagcagcctgatggtgcatacagggtcacgttaagtggtttgatggtccaa
atacacccgtcttctgtcttgttccgagccaagccagagtgtatagttttcaatgaactc
gtccgtactaatcatagttatgtccgtaatgtttctagaatcgattacttgtggctcatc
gagctggctcctcacttgtacgcggtgcaagactaa

DBGET integrated database retrieval system