KEGG   Chloroflexus aurantiacus: Caur_2201Help
Entry
Caur_2201         CDS       T00639                                 

Definition
(RefSeq) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00740  Riboflavin metabolism
cau00790  Folate biosynthesis
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Caur_2201
   00790 Folate biosynthesis
    Caur_2201
Enzymes [BR:cau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Caur_2201
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Caur_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 5826661
NCBI-ProteinID: YP_001635799
UniProt: A9WFR0
Position
2999721..3000929
Genome map
AA seq 402 aa AA seqDB search
MFASVEEALRDYAAGRMIIIVDDADRENEGDLACAAQHVTAETIAFMAREGRGLICLALA
GEIADRLGLEPMVRQNRARFGTNFTVSIEAAHGVTTGISAADRAHTIRVAVDPHSGPHDL
VQPGHVFPLRAAPNGVLERRGQTEAAVDLARLAGLRPAGVICEIMNDDGTMARGPDLVRF
AVRHNLKIISVEQLVAYRKRHERLIERMAEAQLPTRYGTFRAVSYSARCAPHEAVALIIG
HPKPDQPILVRLHSECLTGDVFGSLRCDCGEQIDTALHQMAAAGCGVLVYLRQEGRGIGL
HNKLRAYALQEQGFDTVAANEQLGFPADLRDYTVGAQILTDLGVRTVHLLTNNPQKVAAL
REFGFAVTQVPICGTPNPHNIAYLLTKRNRLGHQLECIYDHL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcatcagtggaagaagcgctgcgcgattacgcggctggccggatgatcatcatc
gttgatgatgctgatcgcgagaatgagggcgatctggcctgtgctgcacaacacgtcact
gctgaaacaattgcatttatggcgcgcgaagggcgggggctgatctgtctggcgctcgcc
ggcgagatagccgaccgtctggggctagagccgatggtacggcagaatcgggctcgtttc
ggtaccaattttacggtatcaattgaagctgctcacggcgttaccaccggtatctcggct
gccgaccgggcgcatacgattcgcgttgcggttgacccacacagtggcccgcacgatctg
gtacaaccgggtcacgtctttcccctgcgggctgcgcccaacggtgtcctggagcggcgc
ggtcagacggaagcggcagttgatctggcccggctggcgggcctgcgaccggctggtgtc
atctgcgaaataatgaacgacgatggtacgatggcccgtggccctgatcttgtccgcttc
gccgtcaggcacaacctcaagatcatcagcgtcgagcaactggttgcctaccgcaaacgt
cacgaacgtctgattgagcgcatggccgaagcgcagcttccaacccgctatggcacgttt
cgcgccgtctcgtacagcgcccgttgtgccccccacgaagcagttgcgctgatcatcggt
catcccaaacctgatcagccgatcctggtgcgcctccactctgaatgcctgaccggtgat
gtatttgggagtctccgctgcgattgcggcgagcagatcgataccgcgctgcatcagatg
gctgctgccggctgtggggtattggtctacctgcgccaggaaggtcgtggcatcggcctg
cacaacaaactgcgcgcctatgccctacaagaacagggatttgacaccgtggccgcaaac
gaacaactcggcttccctgccgatctgcgcgactatacggttggcgcacagattcttacc
gatctcggcgtgcgcaccgttcatctgctgaccaacaacccgcagaaagtagctgcctta
cgcgaatttggctttgccgtgacgcaggttcccatctgtggtacaccaaatccgcacaac
attgcctatctgctcaccaaacggaatcgtctaggacatcaactggagtgcatctatgac
catctatga

DBGET integrated database retrieval system