KEGG   Clostridium botulinum A ATCC 19397: CLB_1313
Entry
CLB_1313          CDS       T00574                                 

Definition
(GenBank) putative xanthine dehydrogenase, molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00230  Purine metabolism
cba01100  Metabolic pathways
cba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLB_1313
Enzymes [BR:cba01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLB_1313
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ABS32749
Position
1364820..1367117
AA seq 765 aa
MEDSYDLIGKSINRVDAVAKVTGRAKYCSDHFEANSLVGMVLRSPYAHAKVKNIDTKEAE
SLDGVEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYVLLTDKARFVGDAVAAVIATDE
LIAKKALKLIKVEYEVLPFVIDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDEVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKLDEKGRMLIITSTQIPHIVRRIVSKACNLPIGKI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIVATRTRHAMRVNIKI
ALSKDNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMIDDICNDLNIDPVDFRLNSFIKKGHIDKESDLVVRTFGLPEC
LKRGRKLIDWEGKRELYKNQNGPIRKGVGMACFSYFSGTWPVSLEAAGTRIVMNQDGSVQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAATEVKRKALKIASDKCGLDAELLDIVDAKVIEKGLRRELYTLEEIAMEAYYNREKY
APITSDLTVKVKNNAIAYGATFVEVEVDIRTGKIKVLDIYNIHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDEKTGSIINNNLLHYKLPTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQSVFEKFKEVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgatttaattggaaaaagcataaatagagtagatgcagtagctaaa
gttacaggtagagctaagtattgctcagatcattttgaagctaattcacttgtaggaatg
gttttaagaagtccctatgctcatgcaaaagtaaaaaatatagatactaaagaagctgaa
agcttagatggtgttgaagctgtattaacgtataaaaatgtaccaaatacgaaatttcct
acggcaggacatccatattcattagatccaagtcatagagacatagaagattatgtatta
cttacagacaaagcacgctttgtaggagatgcagttgcagcagttattgcgactgatgaa
cttatagccaaaaaagccttaaaattaataaaagtagaatatgaagttttgccttttgta
atcgatcaagaagaagcaataaaagagggagctcctgttattcatgatgaaaggcccaat
aatatagttagtgattttggtataacagtaggagatccagatgaagtatttaaaaatgca
gataaaatttataaaggtcaatatgaaactcaaatagtgcaacattgtcaaatggaaacg
cacaatgctatggcaaagcttgatgagaaaggtagaatgcttattataacatcaacacaa
ataccacatattgtacgaagaatagtttcaaaagcttgtaatttacctattggtaaaata
agagtaataaagccttatgttggtggaggctttggaggaaagcaagatgttataatagaa
ccacttacagctataatgtctcttgcagttaatggaagatgtgtaaggttacaattaagt
agagaagaggcaattgttgcaactagaacaagacatgcaatgagagtaaatatcaaaata
gctttatcaaaagataataaaatagaaggttatgatatagagaactttgtaaataatgga
gcttatgcatcccatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagaaaaatatcgtcccaaaactatatatactaatcttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatgattgat
gatatatgtaatgatctaaatatagaccctgtagattttagacttaatagttttataaag
aaaggtcatatagataaggaatcagatcttgtagttagaacctttggattaccagaatgt
ttaaaaagaggtagaaaattaatagattgggagggaaaaagagaattatataaaaatcaa
aatggtcctataagaaaaggtgttggaatggcctgttttagttatttttcaggaacttgg
ccagtatcacttgaggcagcgggaacaagaatagtaatgaatcaagatggttcagtccaa
gttcaagtaggagctacagaaataggacagggtagtgatacagtatttagtcaaatggca
gcagaaactattggaataccatttgatatggtaacaatagtctcccagcaagatacagat
attactccttttgatacaggatcctatgcatcaagacaatcttttatagcaggccaagct
ataaaaaaagcagcaacagaagtaaaaagaaaagctctaaaaattgccagtgataaatgt
ggattagatgcagagcttttggatattgtagatgcaaaggtgatagaaaaaggattaaga
agagaactttatactttagaagaaattgcgatggaggcatattacaatagagaaaaatat
gcacctataacaagtgatttaaccgtaaaggttaaaaataatgctatagcctatggggca
acctttgtagaagtagaagttgatataagaacaggaaaaataaaagttttagatatttat
aacatacatgattcaggaaaaattttaaataaaaagttagcagaaggacaagtacacggt
ggtgttagtatggctttaggatttgccttatcagaaaaattcataatagatgagaaaaca
ggatctataataaacaataatcttttacattataaacttccaactattatggatactcca
aacataaaatgtgaatttgtaaatacctatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatctctccagctccagctatacgtaatgccgtattaaatgca
acaggagtagcatttaataaattgccaatggatgctcaatctgtttttgagaaatttaaa
gaggttggacttatatag

DBGET integrated database retrieval system