KEGG   Clostridium botulinum B1 Okra: CLD_3283
Entry
CLD_3283          CDS       T00671                                 

Definition
(GenBank) putative xanthine dehydrogenase, molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00230  Purine metabolism
cbb01100  Metabolic pathways
cbb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLD_3283
Enzymes [BR:cbb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLD_3283
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ACA44694
UniProt: B1IJQ2
Position
1412351..1414648
AA seq 765 aa
MEDSYDLIGKSINRVDAVAKVTGRAKYCSDHFEANSLVAMVLRSPYAHAKVKNIDTKEAE
SLDGVEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYVLLTDKARFVGDAVAAVIATDE
LIAKKALKLIKVEYEVLPFVIDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDEVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKLDEKGRMLIITSTQIPHIVRRIVSKACNLPIGKI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIIATRTRHAMRVNIKI
ALSKDNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMIDDICNDLNIDPVDFRLNSFIKKGHIDKASDLVVRTFGLPEC
LKRGRKLIDWDRKRELYKNQNGPIRKGVGMACFSYFSGTWPVSLEAAGTRIVMNQDGSVQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAATEVKRKVLKIASDKCGLDAELLDIVDAKVIEKGLRRELYTLEEIAMEAYYNREKY
APITSDLTVKVKNNAIAYGATFVEVEVDIRTGKIKVLDIYNIHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDEKTGSIINNNLLHYKLPTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQSVFEKFKEVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgatttaattggaaaaagcataaatagagtagatgcagtagctaaa
gttacaggtagagctaagtattgctcagatcattttgaagctaattcacttgtagcaatg
gttttaagaagtccctatgctcatgcaaaagtaaaaaatatagatactaaagaagctgaa
agcttagatggtgttgaagctgtattaacgtataaaaatgtaccaaatacgaaatttcct
acggcaggacatccatattcattagatccaagtcatagagacatagaagattatgtatta
cttacagacaaagcacgctttgtaggagatgcagttgcagcagttattgcgactgatgaa
cttatagccaaaaaagccttaaaattaataaaagtagaatatgaagttttgccttttgta
atcgatcaagaagaagcaataaaagagggagctcctgttattcatgatgaaagaccaaat
aatatagttagtgattttggtataacagtaggagatccagatgaagtatttaaaaatgca
gataaaatttataagggtcaatatgaaactcaaatagtgcaacattgtcaaatggaaacg
cacaatgctatggcaaagcttgatgagaaaggtagaatgcttattataacatcaacacaa
ataccacatattgtacgaagaatagtttcaaaagcttgtaatttacctattggtaaaata
agagtaataaagccttatgttggtggaggctttggaggaaagcaagatgttataatagaa
ccacttacagctataatgtctcttgcagttaatggaagatgtgtaaggttacaattaagt
agagaagaggcaattattgcaactagaacaagacatgcaatgagagtaaatatcaaaata
gctttatcaaaagataataaaatagaagggtatgatatagagaactttgtaaataatgga
gcttatgcatcccatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagaaaaatatcgccccaaaactatatatactaatcttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatgattgat
gatatatgtaatgatctaaatatagaccctgtagattttagacttaatagttttataaag
aaaggtcatatagataaggcatcagatcttgtagttagaacctttggattaccagaatgt
ttaaaaagaggtagaaaattaatagattgggacagaaaaagagaattatataaaaatcaa
aatggtcctataagaaaaggtgttggaatggcctgtttcagttatttttcaggaacttgg
ccagtatcacttgaggcagcgggaacaagaatagtaatgaatcaagatggttcagtccaa
gttcaagtaggagctacagaaataggacagggtagtgatacagtatttagtcaaatggca
gcagaaactattggaataccatttgatatggtaacaatagtctcccagcaagatacagat
attactccttttgatacaggatcctatgcatcaagacaatcttttatagcaggccaagct
ataaaaaaagcagcaacagaagtaaaaagaaaagttctaaaaattgccagtgataaatgt
ggattagatgcagagcttttggatattgtagatgcaaaggtgatagagaaaggattaaga
agagaactttatactttagaagaaattgcgatggaggcatattacaatagagaaaaatat
gcacctataacaagtgatttaaccgtaaaggttaaaaataatgctatagcctatggggca
acctttgtagaagtagaagttgatataagaacaggaaaaataaaagttttagatatttat
aacatacatgattcaggaaaaattttaaataaaaagttagcagaaggacaagtacatggt
ggtgttagtatggctttaggatttgccttatcagaaaaattcataatagatgagaaaaca
ggatctataataaacaataatcttttacattataaacttccaactattatggatactcca
aatataaaatgtgaatttgtaaatacctatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatctctccagctccagctatacgcaatgccgtattgaatgca
acaggagtagcatttaataaattaccaatggatgctcaatctgtttttgagaaatttaaa
gaggttggacttatatag

DBGET integrated database retrieval system