KEGG   Clostridium botulinum F Langeland: CLI_1370
Entry
CLI_1370          CDS       T00563                                 

Definition
(GenBank) xanthine dehydrogenase family protein, molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00230  Purine metabolism
cbf01100  Metabolic pathways
cbf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLI_1370
Enzymes [BR:cbf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLI_1370
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ABS42359
UniProt: A7GCX5
Position
1429868..1432165
AA seq 765 aa
MEDSYDLIGKSINRVDAVAKVTGRAKYCSDHFEANSLVGMVLRSPYAHAKVKNIDTKEAE
SLDGIEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYVLLTDKARFVGDAVAAVIATDE
LIAKKALKLIKVEYEVLPFVIDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDKVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKLDEKGRMLIITSTQIPHIVRRIVSKACNLPIGKI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIVATRTRHAMRVNIKI
ALSKDNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMIDDICNDLNIDPVDFRLNSFIKKGHIDKASDLVVRTFGLPEC
LKRGRKLIDWDGKRELYKNQNGPIRKGVGMACFSYFSGTWPVSLEAAGARIVMNQDGSVQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAATEVKRKVLKIASDKCGLDAELLDIVDAKVIEKGLRRELYTLEEIAMEAYYNREKY
APITSDLTVKVKNNAIAYGATFVEVEVDIRTGKIKVLDIYNIHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDEKTGSIINNNLLHYKLPTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQSVFEKFKEVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgatttaattgggaaaagcataaatagagtagatgcagtagctaaa
gttacaggtagagctaagtattgctcagatcattttgaagctaattcacttgtaggaatg
gttttaagaagtccctatgctcatgcaaaagtaaaaaatatagatactaaagaagctgaa
agcttagatggtattgaagctgtattaacgtataaaaatgtaccaaatacgaaatttcct
acggcaggacatccatattcattagatccaagtcatagagacatagaagattatgtatta
cttacagacaaagcacgctttgtaggagatgcagttgcagcagttattgcgactgatgaa
cttatagccaaaaaagccttaaaattaataaaagtagaatatgaagttctgccttttgta
atagatcaagaagaagcaataaaagagggagctcctgttattcatgatgaaagaccaaat
aatatagttagtgattttggtataacagtaggagatccagataaagtatttaaaaatgca
gataaaatttataaaggtcaatatgaaactcaaatagtgcaacattgccaaatggaaacg
cacaatgctatggcaaagcttgatgagaaaggtagaatgcttattataacatcaacacaa
ataccacatattgtacgaagaatagtttcaaaagcttgtaatttacctattggtaaaata
agagtaataaagccttatgttggtggaggctttggaggaaagcaagatgttataatagaa
ccacttacagctataatgtctcttgcagttaatggaagatgtgtaaggttacaattaagt
agagaagaggcaattgttgcaactagaacaagacatgcaatgagagtaaatatcaaaata
gctttatcaaaagataataaaatagaaggttatgatatagaaaactttgtaaataatgga
gcttatgcatcccatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagaaaaatatcgccccaaaactatatatactaatcttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatgattgat
gatatatgtaatgatctaaatatagaccctgtagattttagacttaatagttttataaag
aaaggtcatatagataaggcatcagatcttgtagttagaacatttggattaccagaatgt
ttaaaaagaggtagaaaattaatagattgggacggaaaaagagaattatataaaaatcaa
aatggtcctataagaaaaggtgttggaatggcctgttttagttatttttcaggaacttgg
ccagtatcacttgaggcagcgggggcaagaatagtaatgaatcaagatggttcagtccaa
gttcaagtaggagctacagaaataggacagggtagtgatacagtatttagtcaaatggca
gcagaaactattggaataccatttgatatggtaacaatagtctcccagcaagatacagat
attactccttttgatacaggatcctatgcatcaagacaatcttttatagcaggtcaagct
ataaaaaaagcagcaacagaagtaaaaagaaaagttctaaaaattgccagtgataaatgt
ggattagatgcagagcttttggatattgtagatgcaaaggtgatagaaaaaggattaaga
agagaactttatactttagaagaaattgcgatggaggcatattacaatagagaaaaatat
gcacctataacaagtgatttaaccgtaaaggttaaaaataatgctatagcctatggggca
acctttgtagaagtagaagttgatataagaacaggaaaaataaaagttttagatatttat
aacatacatgattcaggaaaaattttaaataaaaagttagcagaaggacaagtacacggt
ggtgttagtatggctttaggatttgccttatcagaaaaattcataatagatgagaaaaca
ggatctataataaacaataatcttttacattataaacttccaactattatggatactcca
aacataaaatgtgaatttgtaaatacctatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatctctccagctccagctatacgtaatgccgtattaaatgca
acaggagtagcatttaataaattgccaatggatgctcaatctgtttttgagaaatttaaa
gaggttggacttatatag

DBGET integrated database retrieval system