KEGG   Clostridium botulinum A Hall: CLC_1323
Entry
CLC_1323          CDS       T00575                                 

Definition
(RefSeq) xanthine dehydrogenase subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00230  Purine metabolism
cbh01100  Metabolic pathways
cbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLC_1323
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLC_1323
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 5398309
NCBI-ProteinID: YP_001387189
UniProt: A5I1C2
Position
1365314..1367611
AA seq 765 aa
MEDSYDLIGKSINRVDAVAKVTGRAKYCSDHFEANSLVGMVLRSPYAHAKVKNIDTKEAE
SLDGVEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYVLLTDKARFVGDAVAAVIATDE
LIAKKALKLIKVEYEVLPFVIDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDEVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKLDEKGRMLIITSTQIPHIVRRIVSKACNLPIGKI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIVATRTRHAMRVNIKI
ALSKDNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMIDDICNDLNIDPVDFRLNSFIKKGHIDKESDLVVRTFGLPEC
LKRGRKLIDWEGKRELYKNQNGPIRKGVGMACFSYFSGTWPVSLEAAGTRIVMNQDGSVQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAATEVKRKALKIASDKCGLDAELLDIVDAKVIEKGLRRELYTLEEIAMEAYYNREKY
APITSDLTVKVKNNAIAYGATFVEVEVDIRTGKIKVLDIYNIHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDEKTGSIINNNLLHYKLPTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQSVFEKFKEVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgatttaattggaaaaagcataaatagagtagatgcagtagctaaa
gttacaggtagagctaagtattgctcagatcattttgaagctaattcacttgtaggaatg
gttttaagaagtccctatgctcatgcaaaagtaaaaaatatagatactaaagaagctgaa
agcttagatggtgttgaagctgtattaacgtataaaaatgtaccaaatacgaaatttcct
acggcaggacatccatattcattagatccaagtcatagagacatagaagattatgtatta
cttacagacaaagcacgctttgtaggagatgcagttgcagcagttattgcgactgatgaa
cttatagccaaaaaagccttaaaattaataaaagtagaatatgaagttttgccttttgta
atcgatcaagaagaagcaataaaagagggagctcctgttattcatgatgaaaggcccaat
aatatagttagtgattttggtataacagtaggagatccagatgaagtatttaaaaatgca
gataaaatttataaaggtcaatatgaaactcaaatagtgcaacattgtcaaatggaaacg
cacaatgctatggcaaagcttgatgagaaaggtagaatgcttattataacatcaacacaa
ataccacatattgtacgaagaatagtttcaaaagcttgtaatttacctattggtaaaata
agagtaataaagccttatgttggtggaggctttggaggaaagcaagatgttataatagaa
ccacttacagctataatgtctcttgcagttaatggaagatgtgtaaggttacaattaagt
agagaagaggcaattgttgcaactagaacaagacatgcaatgagagtaaatatcaaaata
gctttatcaaaagataataaaatagaaggttatgatatagagaactttgtaaataatgga
gcttatgcatcccatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagaaaaatatcgtcccaaaactatatatactaatcttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatgattgat
gatatatgtaatgatctaaatatagaccctgtagattttagacttaatagttttataaag
aaaggtcatatagataaggaatcagatcttgtagttagaacctttggattaccagaatgt
ttaaaaagaggtagaaaattaatagattgggagggaaaaagagaattatataaaaatcaa
aatggtcctataagaaaaggtgttggaatggcctgttttagttatttttcaggaacttgg
ccagtatcacttgaggcagcgggaacaagaatagtaatgaatcaagatggttcagtccaa
gttcaagtaggagctacagaaataggacagggtagtgatacagtatttagtcaaatggca
gcagaaactattggaataccatttgatatggtaacaatagtctcccagcaagatacagat
attactccttttgatacaggatcctatgcatcaagacaatcttttatagcaggccaagct
ataaaaaaagcagcaacagaagtaaaaagaaaagctctaaaaattgccagtgataaatgt
ggattagatgcagagcttttggatattgtagatgcaaaggtgatagaaaaaggattaaga
agagaactttatactttagaagaaattgcgatggaggcatattacaatagagaaaaatat
gcacctataacaagtgatttaaccgtaaaggttaaaaataatgctatagcctatggggca
acctttgtagaagtagaagttgatataagaacaggaaaaataaaagttttagatatttat
aacatacatgattcaggaaaaattttaaataaaaagttagcagaaggacaagtacacggt
ggtgttagtatggctttaggatttgccttatcagaaaaattcataatagatgagaaaaca
ggatctataataaacaataatcttttacattataaacttccaactattatggatactcca
aacataaaatgtgaatttgtaaatacctatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatctctccagctccagctatacgtaatgccgtattaaatgca
acaggagtagcatttaataaattgccaatggatgctcaatctgtttttgagaaatttaaa
gaggttggacttatatag

DBGET integrated database retrieval system