KEGG   Clostridium botulinum Ba4: CLJ_B3471Help
Entry
CLJ_B3471         CDS       T00895                                 

Gene name
bcd
Definition
(GenBank) butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00071  Fatty acid degradation
cbi00280  Valine, leucine and isoleucine degradation
cbi00410  beta-Alanine metabolism
cbi00640  Propanoate metabolism
cbi00650  Butanoate metabolism
cbi01100  Metabolic pathways
cbi01110  Biosynthesis of secondary metabolites
cbi01120  Microbial metabolism in diverse environments
cbi01130  Biosynthesis of antibiotics
cbi01200  Carbon metabolism
cbi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLJ_B3471 (bcd)
   00650 Butanoate metabolism
    CLJ_B3471 (bcd)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLJ_B3471 (bcd)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLJ_B3471 (bcd)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLJ_B3471 (bcd)
Enzymes [BR:cbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     CLJ_B3471 (bcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: ACQ54081
UniProt: A0A3F2ZYW7
Position
complement(3485931..3487070)
Genome map
AA seq 379 aa AA seqDB search
MEFGLSQEQKLVKQMLMEFVENEVEPIAADIDKTERYPIETVEKMSKYGIMGMPFPKEYG
GAGTDYLSYVIAVEELAKECATTSVILSAHTSLCCAPIFEFGTEEQKKKYLPDLLSGKKI
GAFGLTEPNAGTDASAQQSIAVLKGDHYILNGSKIFITNGGAADTFVIFAMTDRSKGVKG
ISAFILEKGMPGFSIGKTEDKMGIRASSTTELIFEDVKVPKENLLGKEGKGFGIAMKTLD
GGRIGIAAQALGIAEGALDHAIAYMKERKQFGKNLTKFQGLQWYIADMKVRVDAAKYLVY
KSAWKKSAGENYTVDAAEAKLYAAETAMYVTNKSLQVLGGYGYTKDYPLERMLRDARITE
IYEGTSEVQKMVIANNLLH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaatttggtttatcacaagagcaaaaacttgttaagcaaatgctaatggaatttgta
gaaaatgaagtagaaccaatagctgcagatatagataagacagaaagatatccaattgaa
acggtagagaaaatgtctaaatatggaataatgggaatgccattcccaaaggaatatggt
ggagcaggtactgattatttgagctatgttatagcagtagaagaacttgcaaaagaatgt
gcaactacatctgttattttatcagcacatacatctttatgttgcgctccaatattcgaa
tttggaacagaagagcaaaagaaaaaatatttaccggatcttttaagtggtaaaaagata
ggtgcttttggtttaacagaacctaatgctggtacagatgcatctgctcaacaaagtata
gctgttttaaaaggagatcattatatattaaatggatcaaagatatttataactaatggt
ggagcagcagatacatttgtaatatttgctatgacagatagaagtaagggcgttaaagga
atttccgcatttatattagaaaagggaatgcctggatttagcattggtaagacagaggat
aaaatgggaataagagcatcatcaactactgaacttatatttgaagatgtaaaagttcca
aaagaaaatttacttggtaaagaaggaaaaggattcggtatagccatgaaaactttagat
gggggaagaattggaatagcagctcaagcattaggaatagcagaaggagctttagatcac
gctattgcatatatgaaagaaagaaaacaattcggtaaaaatcttactaaatttcaagga
ttgcaatggtatatagcagatatgaaagtgagagtagatgctgctaaatatcttgtttac
aaatcagcatggaaaaaatctgcaggagaaaattacacagttgatgcagctgaggctaaa
ctgtatgcagctgaaacagctatgtatgtaacaaataaatctctacaagtattgggtgga
tatggatatactaaggattatccattagaaagaatgttaagagatgctagaataactgaa
atatatgaaggaacttcagaagtacaaaaaatggttatagctaataacttattacactag

DBGET integrated database retrieval system