KEGG   Clostridium botulinum A3 Loch Maree: CLK_0727
Entry
CLK_0727          CDS       T00670                                 

Definition
(GenBank) putative xanthine dehydrogenase, molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00230  Purine metabolism
cbl01100  Metabolic pathways
cbl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLK_0727
Enzymes [BR:cbl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLK_0727
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ACA54385
UniProt: B1L002
Position
1463420..1465717
AA seq 765 aa
MEDSYDLIGKSINRVDAVAKVTGRAKYCSDHFEANSLVGMVLRSPYAHAKVKNIDTKEAE
SLDGVEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYVLLTDKARFVGDAVAAVVATDE
LIAKKALKLIKVEYEVLPFVIDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDEVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKLDEKGRMLIITSTQIPHIVRRIVSKACNLPIGKI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIVATRTRHAMRVNIKI
ALSKDNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMIDDICNDLNIDPVDFRLNSFIKKGHIDKASDLVVRTFGLPEC
LKRGRKLIDWDRKRELYKNQNGPIRKGVGMACFSYFSGTWPVSLEAAGTRIVMNQDGSIQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAATEVKRKVLKIASDKCGLDAELLDIVDAKVIEKGLKRELYTLEEIAMEAYYNREKY
APITSDLTVKVKNNAIAYGATFVEVEVDIRTGKIKVLDIYNIHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDQKTGSIINNNLLHYKLPTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQSVFEEFKKVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgatttaattggaaaaagcataaatagagtagacgcagtagctaaa
gttacaggtagagctaagtattgctcagatcattttgaagctaattcacttgtaggaatg
gttttaagaagtccctatgctcatgcaaaagtaaaaaatatagatactaaagaagctgaa
agtttagatggtgttgaagctgtattaacgtataaaaatgtaccaaatacgaaatttcct
acggcaggacatccatattcattagatccaagtcatagggacatagaagattatgtatta
cttacagacaaagcacgttttgtaggagatgcagttgcagcagttgttgccactgatgag
cttatagccaaaaaagccttaaaattaataaaagtagaatatgaagttttgccttttgta
atcgatcaagaagaagcgataaaagagggagctcctgttattcatgatgaaagacccaat
aatatagttagcgattttggtataacagtaggagatccagatgaagtatttaaaaatgca
gataaaatttataaaggtcaatatgaaactcaaatagtgcaacattgtcaaatggaaacg
cacaatgctatggcaaagcttgatgagaaaggtagaatgcttattataacatcaacacaa
ataccacatattgtacgaagaatagtttcaaaagcttgtaatttacctattgggaaaata
agagtaataaagccttatgttggtggaggctttggaggaaaacaagatgttataatagag
ccacttacagctataatgtctcttgcagttaatggaagatgtgtaaggttacaattaagt
agagaagaggcaattgttgcaactagaacaagacatgcaatgagagtaaatatcaaaata
gctttatcaaaagataataaaatagaaggttatgatatagagaactttgtaaataatgga
gcttatgcatcccatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagaaaaatatcgccccaaaactatatatactaatcttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatgattgat
gatatatgtaatgatttaaatatagaccctgtagattttagacttaatagttttataaag
aaaggtcatatagataaggcatcagatcttgtagttagaacctttggattaccagaatgt
ttaaaaagaggtagaaaattaatagattgggacagaaaaagagaattatataaaaatcaa
aatggtcctataagaaaaggtgttggaatggcttgttttagttatttttcaggaacttgg
ccagtatcacttgaggcagctggaacaagaatagtaatgaatcaagatggttcaatccaa
gttcaagtaggagctacagaaataggacagggtagtgatacagtatttagtcaaatggca
gcagaaactattggaataccatttgatatggtaacaatagtctcccagcaagatacagat
attactccttttgatacaggatcctatgcatcgagacaatcttttatagcaggccaagct
ataaaaaaagcagcaacagaagtaaaaagaaaagttctaaaaattgccagtgataaatgt
ggattagatgcagagcttttggatattgtagatgcaaaggtaatagaaaaaggattaaag
agagaactttatactttagaagaaattgcgatggaggcatattacaatagagaaaaatat
gcccctataacaagtgatttaaccgtaaaggttaaaaataatgctatagcctatggggca
acttttgtagaagtagaagttgatataagaacaggaaaaataaaagttttagatatttat
aacatacatgattcaggaaaaattttaaataaaaagttagcagaaggacaagtacacggt
ggtgttagtatggctttaggatttgccttatcagaaaaattcataatagatcaaaaaaca
ggatcaataataaacaataatcttttacattataaacttccaactattatggatactccg
aacataaaatgtgaatttgtaaatacctatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatctctccagctccagctatacgtaatgccgtattgaatgca
acaggagtagcatttaataaattaccaatggatgctcaatctgtttttgaggaatttaaa
aaggttggacttatatag

DBGET integrated database retrieval system