KEGG   Citrobacter braakii: A6J81_09730Help
Entry
A6J81_09730       CDS       T04825                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cbra  Citrobacter braakii
Pathway
cbra00520  Amino sugar and nucleotide sugar metabolism
cbra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A6J81_09730
Enzymes [BR:cbra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     A6J81_09730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ARC40974
Position
1954805..1955953
Genome map
AA seq 382 aa AA seqDB search
MYALTQGRIFTGHEILDDHAIVVANGLIDSVCPLAELPSGIEQRSLNGAIVSPGFIDVQL
NGCGGVQFNDTAEAVTVETLEIMQKANEKSGCTSYLPTLITTSDDLMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPGFVRQPDAALVDFLCDNADVITKVTLAPEMVPVEV
ITKLVNAGIVVSAGHSNATVKEAKIGFRAGITFATHLFNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYVNIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHANIALDEVLRMATLYPARAIGVDKQLGSIAPGKVANL
TAFTHDFKIIKTIVNGNEVVTE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctttaacccagggccggatctttaccggtcacgaaattcttgatgaccatgcg
attgttgtcgccaatggcctgattgacagcgtttgcccactggctgagttaccgtcagga
attgaacagcgctcactgaatggggccattgtttcccccggttttattgatgtacagcta
aacggctgcggcggcgtacagtttaacgatacggcagaagccgtgaccgttgaaacgctg
gaaatcatgcagaaagccaatgaaaaatccggctgcaccagctacctgccaacgcttatt
accaccagcgatgacctgatgaaacaaggcgttcgcgtcatgcgtgaatacctggcgaaa
cacccaaatcaggcattagggcttcatcttgaaggtccgtggctgaatctggtgaaaaaa
ggtactcataatccgggatttgtccgtcagccggacgctgcgctggtcgatttcctgtgc
gataatgccgatgtgatcaccaaagtgacgctggcgccagaaatggtcccggtcgaggtc
atcaccaaactggtaaatgcaggtattgttgtttctgcaggtcactcaaatgcgacggta
aaagaagcaaaaatcggcttccgcgcaggcatcacctttgcgacacatctgttcaacgcg
atgccgtatattaccggccgtgagcccggtctggcgggtgcgattcttgatgaagccgat
atctattgcggtatcatcgccgatggcctgcacgttgactacgttaacattcgtaatgcc
aaacgcctgaaaggcgacaagctgtgcctggtcaccgatgcgaccgcgccggcaggtgca
aacattgaacagttcattttcgctggtaaaacaatatactaccggaatggattgtgcgtt
gatgagaacggtacgttgagcggttcatcattaaccatgattgaaggcgtacgcaatctg
gtcgaacatgcgaatatcgctctcgacgaagtcttacgcatggcaacgctctaccctgct
cgcgccattggcgtcgacaaacaactcggcagcatcgcgccaggcaaagtagccaacctg
actgcgttcacgcacgactttaaaatcatcaagaccatcgttaatggcaacgaggtcgtt
actgagtaa

DBGET integrated database retrieval system