KEGG   Clostridium botulinum E3: CLH_0597
Entry
CLH_0597          CDS       T00767                                 

Definition
(GenBank) putative xanthine dehydrogenase, molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00230  Purine metabolism
cbt01100  Metabolic pathways
cbt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLH_0597
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLH_0597
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ACD53538
Position
602624..604915
AA seq 763 aa
MTNNIVGNSVIRFDAVSKVTGKAKYVDDFFVSDMLIGKVLRSPYAHAIVKNIDTSKAKKL
DGVEAVITHEDLPKIKFATAGHPWSLDPSHRDIEDRLILTNKARFVGDAIAAVVAVDEIV
AKNALELIEVDYEVLEPIVKSEDAIKENAPIIHEEKPDNILSSFGSEIGNVEEDLKNADR
IFEGSFETSMVQHCHMENHSTYAYVDGEDRIVIVSSTQIPHIVRRIVGQALGIQWGKIKV
IKPYIGGGFGNKQDVVIEPLTAAMSLAVDGRPVRYTLDREECFIDTRTRHSMKIKFKTAV
SKDGKLISLDIKNLINNGAYASHGHSVALSAGGKFRGVYDFNSIKYSPITVYTNLPAAGA
MRGYGAPQMCYALESHIEDICRALNMDPIEFRTKNFISEGYVEPLSKNVVRAFALPECIE
KGKELIKWDEKKKEYKNQSGDKRRGVGMACFSYFTGTHPVALEPAGARIVMNQDGSVQLQ
IGATEIGQGSDTVFGQMVADILGLRIDMVHVISNQDTDITPFDTGSYASRQTFVSGAAVK
KCALEVKDKVLAFASSKCGLEASELDIEDCKIVEKRLGRVICPLEEIAMESYYDRIKCCP
ITSDTSVNVRINSIAYGATFAAVEVDIKTGKIEVLEIYNIHDSGMIMNPMLAEGQVHGGV
SMGLGYALSEQMLFDEKTGKPLNNNLLDYKLQTIMDTPTIGSAFVEKYEPAGGFGQKSIG
ENTTVSPAPAIRNAVLDATGVAFNKIPMNPQSVFEKFKEVGLV
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgacaaataatatagtaggaaacagcgtaattagatttgatgctgtatctaaagttact
ggtaaagcaaagtatgtagatgatttttttgtgagtgatatgcttataggtaaagtttta
aggagcccttacgctcatgctatagttaaaaatatagatactagtaaggcaaaaaaatta
gatggggtagaagcagttattacacatgaagatttacctaaaattaaatttgctacggct
ggacatccatggtctttagatccaagtcatagagatatagaggatagattaattcttacg
aataaagctagatttgttggagatgccattgctgcagttgtagcagtagatgaaatagta
gcaaaaaacgcgttagaacttatagaggttgattatgaagtccttgaaccaatagtaaag
agcgaagatgctataaaagagaatgcaccaataattcatgaagaaaagccagataatatt
ttaagttcttttggatcagaaattggaaatgtagaagaagatttgaaaaatgcagataga
atatttgaaggaagttttgaaacaagtatggttcaacattgccatatggaaaatcatagc
acatatgcttatgtagatggtgaagaccgtatagttatagtttcttcaactcaaattcct
catattgtaagaagaattgttggacaggcattaggaatacaatggggtaagataaaagtt
attaaaccttatattggtggaggctttggaaataaacaagatgtagttattgaaccatta
acagcagctatgtctcttgcagtagatggaagaccagtaagatatacattagatagagaa
gaatgttttattgatacaaggacaagacattctatgaagattaaatttaaaacagcagta
tcaaaagatggtaaattaatatcattagatataaaaaatcttataaataatggagcttat
gcatctcatggtcattctgttgcattaagtgcaggtggaaaatttagaggagtatatgat
tttaattcaataaaatacagtcctataacagtatatacaaatttaccagcagcaggtgca
atgaggggatatggagcacctcaaatgtgttatgcactagaaagtcatatagaagatatt
tgtagagctcttaatatggatcctatagaatttagaactaaaaattttataagtgaaggt
tatgttgaaccgcttagtaaaaatgtggttcgtgcatttgcattaccagaatgtattgaa
aagggaaaagaattaattaaatgggatgagaaaaagaaagaatataaaaatcaaagtgga
gataaaagaagaggcgtaggtatggcttgctttagttatttcacaggaacacatccagta
gcgttagaaccagctggtgcaagaatagtaatgaaccaagacggatcagttcaattgcag
ataggtgcaacagaaataggacaaggaagtgatactgtttttggacaaatggtagcagat
attcttggattaagaatagatatggtacatgtaatttcaaatcaagatacagatataact
ccttttgatactggatcttatgcatctaggcaaacgtttgtaagtggagcagcagttaag
aaatgtgcattagaagtcaaagataaagtattagcatttgcaagtagtaaatgtggtttg
gaggctagtgaattagatattgaagattgcaaaattgtagaaaaaagattgggtagagtt
atatgtccacttgaagaaattgctatggaatcatattacgatagaattaaatgttgtcct
ataactagtgatacatcagttaatgttagaattaattcaatagcttatggagctacattt
gcagctgtagaagttgatattaaaacagggaaaatagaagttttagaaatatataatatt
catgattctggcatgattatgaatcctatgttagctgaagggcaagtacatggtggagta
agtatgggacttggatatgcattatcagaacaaatgttatttgatgagaagactggtaaa
ccactaaataataatctgttggattataagttacaaactataatggatactcctactatt
ggctcagcttttgtagagaaatatgaaccagcaggtggatttggacaaaaatctattggt
gagaatacaacagtttcaccagcaccagcaattcgtaatgctgttttggatgcgactggg
gttgcatttaataaaatacctatgaatccacaatctgtttttgaaaaatttaaggaagtt
ggattagtgtaa

DBGET integrated database retrieval system