KEGG   Cyanistes caeruleus (blue tit): 111925294
Entry
111925294         CDS       T05602                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccae03000]
    111925294 (AHRR)
Transcription factors [BR:ccae03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111925294 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4 DUF1505
Other DBs
NCBI-GeneID: 111925294
NCBI-ProteinID: XP_023777486
Position
2
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAAVNTN
SSSKGSSAFCEATELYGRNNHHEGAAFSNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILNGFASLKGNLEGLSYNSAIETLGQ
WKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMSQRLNTCPNRRAGSFYNRDQNFLNLASTCPSHWGSAENGQSYSGLQQRCTENYATD
HLKLQRPLISSESLYDTAIPLEMPIKTEYDSDSENIADNYLLSQSRSWLDESGSVRKQVS
SYPNRMHLKTEPDLCEPALPCQKSRHCLYTPHNWQCIIANHPNNLNLNRACKGSRNKEVA
PFCPQNSSVCLENMPDLPHTACYSHFYSPSPGEEKEQVNEGFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNTVHASFPENTLAGPVPRKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcctgcagttgggaacgagaaatccaatccttcgaagagacaccgagaccgcctg
aatgcggagctggaccatctggccagcctccttccttttccacctgacatcgtatcaaag
ctggacaaactttccgtcttgcgccttagtgtcagctatctccgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagttggccaaacgataaaagaagacaat
atatctaataagactgctgtacaagaaggtggacttctactagaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcatcatcaacaattgtggattat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcatgtggat
gaccgccaggatttttgtagacaactgcactgggccatgaatcctccccagatgttgtct
ggacagcaactacagtcagaaacaggagaagaatatattctcagtaaattgttcaaagca
caagagaatgacagcatgacaacagattattcttcctttctaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggattccttacaatgcagttccaaggcaaa
ctaaagttcctctttggacaaagaaagaagtcctcatcaggaacagtattgccacctcag
ctgtccttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgaaagcaaaacacaaagctgatgatgcagcagcagtgaacacaaac
tccagttcaaaaggcagttcagcattttgtgaagcaacagaattatatggaagaaacaat
caccatgaaggtgctgccttcagtaacgcattacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttctctagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagatgaacagctgaagatactaaatggttttgcc
agtttgaaaggaaatctggaggggctttcctataacagtgccattgaaactctgggccag
tggaagcatcttaactgggcagcagtgaagaatgaacaagataatgtaaaagtgaagttt
gagcctcatactaatggtgagtgtttcatgcaagaggaacctctcagttccaacacatca
gttttaggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactcaagt
tcttgttctatgagccagagactgaacacgtgcccaaacaggagagctggatcattctac
aacagagaccaaaatttcttaaatttggcatcaacttgtccttcccactgggggagtgca
gaaaatggccagtcttactcggggctccaacagcgctgtacagagaactatgcaacagac
catctgaagctgcagagaccattaatatcctcagagtctctctatgacacagccattccc
ttggagatgcctatcaaaacagaatatgactctgattctgaaaacattgccgataactac
ctgctttcgcagagccgatcctggctggatgagagcggctcggtgagaaagcaggtctcc
agctatcccaacagaatgcacctcaaaacagaaccggacctctgcgagccagccttgccc
tgccagaagtcaaggcactgcctttatacaccccataattggcaatgcatcatagcaaac
catcccaacaacctgaacttgaacagagcttgcaagggttcacggaacaaggaggtggcc
ccattttgccctcagaactcctccgtgtgtttggaaaacatgcctgacctgccacacaca
gcttgctacagccacttctacagccccagcccaggggaggagaaagagcaggttaatgag
gggttcaaaatgccatgtgaatttaaaaatccctgcttggttcaagcaatcaaacgtgag
ccccttgattctccaccattgtccaacagtggacagaacacagtacatgcgagcttccct
gaaaatacattagcaggtcctgtgcctcgtaaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system