KEGG   Coprinopsis cinerea: CC1G_13871Help
Entry
CC1G_13871        CDS       T01275                                 

Definition
(RefSeq) tryptophan synthetase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
cci  Coprinopsis cinerea
Pathway
cci00260  Glycine, serine and threonine metabolism
cci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01230  Biosynthesis of amino acids
Module
cci_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CC1G_13871
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC1G_13871
Enzymes [BR:cci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CC1G_13871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP His_biosynth NMO
Motif
Other DBs
NCBI-GeneID: 9379836
NCBI-ProteinID: XP_002911835
UniProt: A8NEP3
Position
2
AA seq 704 aa AA seqDB search
MEAIKKVFEQKKAQDATAFVAFVTAGYPKKEDTVPVLLALQAGGADIIELGIPFSDPIAD
GPVIQEANTVALKNDIDYPTVLGQIREARQQGLTAPVLLMGYYNPMLAYGEDKAIQDAAE
AGANGFIMVDLPPEEAIAFRQKCAASNLSYVPLIAPSTTLKRIQFLASIADSFIYVVSKM
GTTGSSANVAVNEELPTILSRIREYTHVPLAVGFGVATRDQFNYVADAGADGVVIGSRIV
NAIKAAGDGEVPQFVENYCREVSGKGEPSRVRSPGAAQRTPSQLTPNAETAKGVENILPA
RFGQFGGQYVPESLVDALAELEEAHKSAIEDPAFWEEVRSLYTYSNRPSNLYLAENLTKE
AGGANIWLKREDLNHTGSHKINNALGQILLAKRIGKTRIIAETGAGQHGVATATVCAKFG
LECVIYMGAEDVRRQALNVFRIEMLGGKAWVIPVHSGSCTLKDAVNEAMRDWVTNLSTTH
YLVGSAIGPHPFPTIVRDFQKVIGEEIKAQLKEVRGKLPDVVVACVGGGSNAIGTFYDFI
PDKSVRLVGVEAGGEGIDGHKHSATLSMGQPGVLHGVRTYILQDKAGQIIETHSISAGLD
YPGVGPEHAWLKDSGRADYVVCTDEDALRGFRMLTQKEGIIPALESSHAIWEGVKIAKSL
PKDKDIVICLSGRGDKDVEQISELLPKWADKLDWHVSSNAIPSK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcaaaaaggttttcgaacagaaaaaggctcaggatgcgactgccttcgtt
gctttcgtgaccgcgggataccccaagaaagaagacactgtaccggtcctgctagcattg
caggctggtggtgcagatatcattgaattgggcattccattctccgatcctattgcagat
ggtcctgttatccaggaagcaaacactgtcgcactcaaaaatgacattgattaccctaca
gttcttggacaaataagagaggcccgacaacaagggcttaccgcgcctgtgttgctcatg
ggctactacaaccctatgttggcctacggagaagacaaggccatccaagatgcagcagag
gccggtgccaatggcttcatcatggtcgatcttccacctgaagaagccatcgctttccgg
caaaaatgtgccgcctccaacctgtcttatgtgccacttattgcaccctccaccaccctc
aaacgaattcaattcctggcttccattgcggactcattcatctatgtcgtctcgaagatg
ggtaccacgggttcctccgccaatgtcgctgtcaacgaagaactgcctaccattctttct
cgcatccgggaatatacccatgtcccactggctgtcggatttggggtcgctacccgggac
cagttcaactacgtcgccgatgctggagcagatggtgttgttattggcagtcgaattgta
aatgccatcaaggccgccggcgatggagaagttccgcaattcgtggagaactattgccga
gaggtatctggaaagggcgagccatcccgcgttcgttctccaggagccgctcaacgcacg
ccatcccagctgactcccaatgccgaaactgcaaagggggtggagaacatccttcccgct
cgttttggccaatttggtggtcaatacgtaccagagtctttggtcgatgcacttgctgag
ctggaggaggctcacaagtcagccatagaagaccccgccttctgggaagaagtccgaagt
ttgtatacctacagcaaccgaccctccaacctctacctcgctgagaatctcaccaaggaa
gctggtggtgccaacatttggttgaagcgagaagacctgaaccataccggatcgcacaag
attaacaacgctctcggccagatcctcctcgccaagcggattggcaagacgcgaatcatc
gcagagaccggtgctggtcaacacggtgtcgccactgcaacagtctgtgccaaatttggc
ctcgaatgtgtcatctacatgggtgccgaggatgtgaggagacaggcactcaacgtcttc
cggattgaaatgttgggtggaaaggcatgggttattcccgttcactccggctcctgtacc
ttgaaagacgcggtcaacgaggccatgcgcgactgggtcaccaatctctcaaccacccac
tatcttgttggatccgccatcggcccccatcccttcccgaccatcgtcagagacttccag
aaagtcatcggagaggagatcaaggcacagctgaaggaagttcgaggaaaactccctgac
gtcgtcgttgcctgtgtcggtggtggcagcaacgccattggaaccttctacgatttcatt
cccgataaatctgttcgccttgtcggtgtcgaagcggggggtgaaggtatcgatggacac
aagcacagcgctaccttgtctatgggccagcccggtgtccttcatggagtcaggacgtac
atcttgcaggataaggcgggtcagattatcgagacccattcgatcagtgccggtctcgac
tatccaggtgtaggacccgagcacgcttggttgaaagactctggtcgtgcagactacgtc
gtttgcaccgacgaagatgctttgcgtggtttccgaatgctcactcagaaagagggcatc
atcccagcgctcgagtcgtcgcacgccatctgggaaggtgtcaagatcgctaaatcactg
ccaaaggataaggacatcgtcatttgcttgtctggccgtggagacaaggatgttgaacaa
atctccgagctgctgcccaagtgggccgataagctcgactggcacgtctcttcgaatgcc
atcccttcgaagtaa

DBGET integrated database retrieval system