KEGG   Campylobacter coli RM5611: YSU_02490Help
Entry
YSU_02490         CDS       T03167                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ccoi  Campylobacter coli RM5611
Pathway
ccoi00740  Riboflavin metabolism
ccoi00790  Folate biosynthesis
ccoi01100  Metabolic pathways
ccoi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccoi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    YSU_02490
   00790 Folate biosynthesis
    YSU_02490
Enzymes [BR:ccoi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     YSU_02490
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     YSU_02490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 MinC_N
Motif
Other DBs
NCBI-ProteinID: AHK74745
Position
498915..499934
Genome map
AA seq 339 aa AA seqDB search
MKFVSIEQAIKDLQEGKMLVMVDAEDRENEGDLIFPAQFSTKEKVNFMIKEARGVVCVAL
AEELARKFELPLMVPKNTSNHETAFTITVDAKDATTGVSAYERDMTIKIFADDNAKASDF
VRPGHINPLIAKKGGVLERTGHTEGTVDLCHLAGLKQACVICEIVKDDGDMARRSDLEEF
CTKHNLNMIAVSDIIEYRLKNESLIKLQEKSDAILAGFKAQKFIFTDHNNAQHIAFAFKE
IQKCENVKFHISGSDFELLTSDKFSKLLDQIRFLSENGGVIVFMQGEKSSVTQFKNYGIG
AQILRYFGIEEIKLMSQSCDKDYIGLKGFGLNLKICNFN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgtaagcattgaacaagcaattaaggatttacaagaaggaaaaatgcttgta
atggtagatgcagaagatagagaaaatgaaggagatttgatttttccagctcaatttagc
actaaagaaaaagtaaattttatgataaaagaagctagaggggttgtgtgtgtagcactc
gcagaagaacttgcaagaaaatttgaacttcctttgatggtgcccaaaaatacttcaaat
catgaaacagcctttacaatcacagtggatgcaaaagatgcaactacaggtgtaagtgct
tatgaaagagatatgacgataaaaatttttgcagacgataatgcaaaagcgagtgatttt
gtacgccctggacatataaatcctttgatagccaaaaaaggcggtgttttagagcgcaca
ggccatacagaaggaacggttgatctttgtcatttagcagggcttaaacaagcttgcgtg
atttgtgagattgttaaagatgatggagatatggcaagaagaagtgatttggaagaattt
tgcactaagcataatctaaacatgatagctgtttctgatatcatagaatatcgcttaaaa
aatgaaagtcttattaaattacaagaaaaaagtgatgctattttagcaggttttaaagca
caaaaattcatttttacagatcataataatgctcagcatatagcatttgcatttaaagaa
attcaaaaatgtgaaaatgttaaatttcatattagcggaagtgattttgagcttttaacc
tctgataaattttctaaattattagatcaaattcgttttttgagtgaaaatggaggagtg
atagtttttatgcagggtgaaaaatcaagtgtaactcaatttaaaaattatggtataggt
gcgcaaattttaagatattttggcatagaagagattaagcttatgtcgcaaagttgtgat
aaggattatataggcttaaaaggctttggtttaaatcttaaaatttgtaattttaactaa

DBGET integrated database retrieval system