KEGG   Camelus dromedarius (Arabian camel): 105106329
Entry
105106329         CDS       T04642                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdk01002]
    105106329 (ADAMTS13)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     105106329 (ADAMTS13)
Peptidases and inhibitors [BR:cdk01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   105106329 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin_3 Reprolysin_4 Reprolysin TSP1_spondin Reprolysin_5 Peptidase_M10 Pep_M12B_propep Reprolysin_2 TSP1_CCN DUF4953
Other DBs
NCBI-GeneID: 105106329
NCBI-ProteinID: XP_031306733
Position
4
AA seq 1556 aa
MRTRELRLLGRCAQGILTSVLFLLGCWGLSDFQQQFLQALEPEEVMAYFGPAATSEVPQF
DVAPLTCVCEEEDGDRQGGAPCGPPRCSLPALGQLFSFSFRPRMGLLAASFTSERVVNAS
LRLLRGPPHPCFTGGRTLLPLGAAARLTYCSGRVEGDIVVGGDRLYIQPLKRQHRELVPP
WGGAQPHLIHRSNPTVHPALVVPGHPLAPRLWRRAAQSVLYLELLVAVGPDVHAVHGEDT
ERYVLTNLNMGSELLRDPSLGAQFQVHLVKMVILTQPEDAPNITANITASLLSVCEWSRT
INPEDDTDPSHADLVLYITRFDLELPDGNRQVRGVTQLGGACSSSWNCLITEDTGFDLGV
TIAHEIGHSFGLEHDGRARSVCGPSGTLCVRRRAPPPWACAWSPCSRRQLLATWSGRARC
MWDPPGSQSGPAGRPPEVHPGLYHDADEQCRIAFGPMAVACTFTREHLDMCQALSCHTDP
LDQSSCSRLLIPLLDGTECGVGKWCSKGHCRSLAELAPIGAVHGHWSSWGPASPCSRSCG
GGVVTRRRQCDNPRPAFGGRACIGADLQAEMCNTQACETTQLEFMSEQCSQTDGKPLYLS
PGSPSFYRWGAAVQYSQGDALCRHMCRAVGESFIVRRGDSFLDGTRCVPSSPREDGTLSL
CVSGSCRTFGCDGRMDSGQVRDACQVCGGDSSTCSPQNGSFRAGRAREYVTFLTITPNLT
SIHIINQRPLFTHLAVRLRGRYIVAGNGSISPSTSYPSLLEDSRVQHKVALTEDRLPRLE
EIHIRGPTWDDMEIQVYRRYGAEYGALARPDVTFTYFQPKRRQAWAWAAVRGACSVSCGA
GLRWVTYSCRDQASGQWVEAARCGGSWQPAAWSESCAPQPCPPYWVAGDFGPCSASCGGG
LQERVVRCVEAQGGLLRTLPHSRCRVLAQQPAAVETCNSQPCPTREVSDTCSSACGADLA
GQNATCVLGTDGAEELVTAGACSTDEKLATLEPCVQAACPPGGGHLDAQAPGEEAASAEG
RARLEAPATHVWTPLAGPCSVSCGRGLRELHFQCTDSALRTAVGEELCGLSSKPGSRWEV
CRAAPCPAWWETRALAPCPVTCGGGQVPLAVRCVRMEQGRSIPLPHSKCWPSPRPRPLED
CSPEPCPARWKVTSLGPCSASCGLGTATRSVACVQLDRGQDTAVDVRACAGLVRPQTRIP
CMTAACTYRWHVSTWLQCSVSCGEGIQRRHDTCLGPRAQVPVPADFCQHLPKPVTVRGCW
AGPCAGQGLPSPAPHEEATAPGQTTAATTGASLERPHPWAHLLSPTPWPQGLLIGTPESP
AESSACGRQHLEPTGTIDMRGPAQADCAVAIGRPLDEVVTLRVLESSLNCSAGEMLLLWG
RLTWRKMCRRLSGMTFSSKANTLVVRQRLVRPGGGVLLRYSSQPALGTFHRECDMQLFGP
RGEIVSPSLSPGGRNVGGCRIFINVAPRARIVIHALATDMGTGTGNQGTDASYILIRDIH
SLRTTTFRGQQTLYWESEGSQAEMEFSQGFLEAHTSLRGHYWTLQTRAPYRGSALP
NT seq 4671 nt   +upstreamnt  +downstreamnt
atgaggacgcgtgagcttcgcctcctggggagatgtgcgcagggaattctcacttctgtg
ctcttcctcctgggctgctggggcctctccgatttccagcagcaatttcttcaggctttg
gagccagaggaagtgatggcttactttggccctgccgctacctccgaagtgccccagttt
gacgtggccccgctcacctgtgtctgtgaagaagaggatggggacaggcagggaggagca
ccctgcgggcccccacgctgctccctgccagccctgggacagctcttctccttctccttc
cggccccggatgggcctcctcgctgcctccttcaccagcgagcgtgtggtgaacgcctcc
ctccggctgctcaggggccccccccacccctgcttcacgggaggccgcaccttgctgccc
ttgggcgcagcagccaggctcacctactgctcgggccgtgtggagggtgacatcgtggtg
ggtggagacaggctctacatccagccattgaagaggcagcaccgggagctggtgccaccc
tggggcggtgctcagccccacctgatccacaggtccaaccccacggtgcacccggccctt
gtggttccaggccaccctctggcccctcgcctctggagacgggctgcccagagtgtcctg
tacctggagctgctggtggccgtgggccctgacgtccacgcagttcacggggaggacaca
gagcgctacgtcctcaccaacctcaacatggggtcagagctgctgagggacccatccctg
ggggctcagttccaagtgcacctggtgaagatggtcatactgacgcagccggaggatgct
ccgaatattacagccaacatcaccgcatcactactgagcgtctgtgagtggagcaggacc
atcaaccccgaggatgacacggatcccagtcatgctgacctggtcctctacatcaccagg
tttgacctggaattgcctgatggtaaccgacaggttcggggggtcacccagctggggggc
gcctgctcctcttcctggaactgcctgatcactgaggatactggcttcgacctgggggtc
accattgcccatgagattgggcacagcttcggcctggagcacgacggccgcgcccgcagc
gtctgcgggcccagcggcacgttatgcgtccgacggcgcgcgccccccccgtgggcctgt
gcgtggtccccctgcagccgccggcagctgctcgcgacctggtcaggacgggcgcgctgc
atgtgggacccgccgggttcgcagtccggacccgcggggcgccctccagaggtgcacccc
ggcctctaccacgatgcggacgagcagtgccgcatagcctttggccctatggcggtcgcc
tgcaccttcaccagggagcaccttgacatgtgccaggctctctcttgccacacagacccc
ctggaccagagcagctgtagccgcctcctcattccgctcctggatgggacagagtgtggt
gtggggaagtggtgctccaagggtcactgccgctccctggcggagctggcccccatcggg
gcagtgcacgggcactggtctagctggggtcccgccagtccctgctcccgctcctgcggc
ggaggggtggtcaccaggaggcggcagtgcgacaaccccaggcctgcctttgggggccgt
gcgtgcataggtgcggacctccaggccgagatgtgcaacactcaggcttgcgagacgacc
cagctggagttcatgtccgagcagtgctcacagaccgacgggaagccgctctacctctcc
ccgggcagcccctccttctaccgctggggcgccgctgtgcagtacagtcaaggggacgct
ctgtgcagacacatgtgccgggctgttggcgagagcttcattgtgaggcgtggggacagt
ttcctggatgggacccgctgtgtgccgagcagccctcgggaggacgggaccctgagccta
tgtgtgtcgggcagctgcaggactttcggctgtgatggcaggatggactctgggcaggtg
cgagacgcgtgccaggtgtgtggaggggacagcagcacgtgtagtccgcagaacggctct
ttcagggctggaagagcgagagaatacgtcacgttcctgaccatcacccccaacctgacc
agcatacacatcataaaccagaggcctctctttacacatctggccgtgaggctccgaggg
cgctacattgtggccgggaatgggagcatctctcccagcacctcctacccctccctcctg
gaggacagccgtgtccagcacaaagtggccctgactgaggaccggctgccccgcctggag
gagatccacatccggggacccacctgggacgacatggagatccaggtttacaggcgctat
ggtgcggagtacggtgccctcgcccgcccagacgtcaccttcacctacttccagcccaag
cggcggcaggcctgggcctgggctgccgtgcggggggcctgctcggtgagctgtggggca
gggctgcgctgggtgacctacagctgtcgggaccaggccagcggccagtgggtggaggct
gcccggtgcggagggagctggcagccggcggcctggtcagagtcctgcgccccccagccc
tgccccccgtactgggtggctggagacttcggcccgtgcagcgcctcctgcgggggcggc
ctgcaggagcgggtggtgcgctgcgtggaggcccagggcggcctcctgaggacgctgccc
cactcccggtgcagagtgctggcccagcagccagcggctgtggaaacctgcaattcccag
ccctgccccacaagggaggtgtcggacacgtgctcatcggcctgtggagcagacctggcc
gggcagaatgcgacttgtgtgctggggacagatggcgcggaggagctggtgactgctggg
gcctgctccacagacgagaagctggctacacttgaaccctgtgtccaggcagcatgtcct
ccaggcgggggccatctggacgcccaggctccgggggaggaggctgcatctgcagagggc
agggccaggctggaggcccctgccacacacgtgtggactcccctggcggggccgtgctcc
gtctcctgcgggcgaggcctgagggagctgcacttccagtgcacggactctgccctcagg
acagccgttggggaagagctgtgtggcttgtcgagcaaacccgggagccggtgggaggtc
tgccgggctgccccgtgcccagcctggtgggagacccgagccttggcaccatgcccagtg
acctgtggagggggacaggtgccgctggctgttcgctgtgtgaggatggaacaaggccgc
tccatccccctgcctcactctaagtgctggccgtcacctcggcccagacccctcgaggac
tgcagcccggagccctgccctgccaggtggaaagtcacgtcccttggcccgtgttcagcc
agctgtggtctcggcactgccacacgctcggtggcctgcgtgcagctggaccgaggccag
gacacggcggtggatgtgcgggcctgtgcgggtctggtgcggccgcagacccgcattccc
tgcatgactgccgcctgcacctaccgctggcatgtcagcacctggctgcagtgctctgtc
tcgtgtggggaaggcattcagcgccggcatgacacctgccttggaccccgggcccaggtg
cccgtgccagccgacttctgccagcatctgcccaagccagtgacagtgcggggctgctgg
gccgggccctgtgcagggcaggggttgcccagcccggcgccccacgaggaagccactgcc
ccaggccagaccacagctgccactactggtgcttccctggagcggccccacccctgggcc
cacctcctctcccccactccctggcctcaaggactcctgattgggaccccagaaagccca
gcagagtccagtgcctgtggccggcagcaccttgagccaacaggaaccattgacatgcga
ggcccagcgcaggctgactgtgcagtggccatcggacggcccctggatgaggtggtgacc
ctccgagtccttgagagctccctcaactgcagcgctggggagatgctgctgctctggggc
aggctcacgtggaggaagatgtgcaggaggctgtccggcatgactttcagctccaaagcc
aacacactggtggtgaggcagcgtcttgtgcggccgggaggcggagtgctgctgcgctat
tcgagccagcctgccctgggaaccttccaccgcgaatgtgacatgcagctttttggaccc
cggggtgaaatcgtgagcccatcgttgagtccaggtggaaggaatgtggggggctgtcgc
atcttcatcaacgtggccccacgggcccggattgtcatccatgccctggccacagacatg
ggcactggaactggaaaccagggaaccgatgccagctacatcttgatccgggacatccac
agcctgaggacaacgacatttcgtgggcagcagacactctactgggagtcagagggcagc
caggcagagatggagtttagccagggcttccttgaggcccacactagccttcggggccat
tactggaccctccagactagagctccttaccgcggcagtgccctgccttag

DBGET integrated database retrieval system