KEGG   Caenorhabditis elegans (nematode): CELE_B0336.6
Entry
CELE_B0336.6      CDS       T00019                                 

Gene name
abi-1
Definition
(RefSeq) SH3 domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Abi_HHR SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 175789
NCBI-ProteinID: NP_498224
WormBase: WBGene00015146
Ensembl: WBGene00015146
UniProt: Q10929
Position
III:complement(join(5690229..5690389,5690874..5691465,5691957..5692398,5692445..5692530,5692578..5692706))
AA seq 469 aa
MSVNDLQELIERRIPDNRAQLETSHANLQQVAAYCEDNYIQSNNKSAALEESKKFAIQAL
ASVAYQINKMVTDLHDMLALQTDKVNSLTNQVQYVSQVVDVHKEKLARREIGSLTTNKTL
FKQPKIIAPAIPDEKQRYQRTPIDFSVLDGIGHGVRTSDPPRAAPISRATSSISGSSPSQ
FHNESPAYGVYAGERTATLGRTMRPYAPSIAPSDYRLPQVTPQSESRIGRQMSHGSEFGD
HMSGGGGSGSQHGSSDYNSIYQPDRYGTIRAGGRTTVDGSFSIPRLSSAQSSAGGPESPT
FPLPPPAMNYTGYVAPGSVVQQQQQQQMQQQNYGTIRKSTVNRHDLPPPPNSLLTGMSSR
MPTQDDMDDLPPPPESVGGSSAYGVFAGRTESYSSSQPPSLFDTSAGWMPNEYLEKVRVL
YDYDAAKEDELTLRENAIVYVLKKNDDDWYEGVLDGVTGLFPGNYVVPV
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgagtgttaatgatcttcaagagctcatcgagcgacggatacccgataatcgagctcaa
ctggaaacgagtcatgcgaatcttcaacaagttgccgcgtattgtgaggataattatata
caatcaaacaataaatctgctgcgctagaggaatccaagaaattcgcgatccaggcactc
gccagcgtagcctaccagattaacaagatggttacagatttacacgatatgcttgctcta
caaaccgataaagtgaactctttaacaaatcaagttcaatatgttagccaagtagttgat
gtacataaagagaagcttgcaagacgagaaattggttctctcacaaccaataaaacatta
ttcaagcaacccaaaatcattgcaccagcaatcccagatgaaaagcagagatatcaacga
acgcccatcgatttttctgttcttgacggaatagggcatggtgtcagaacatcggatcca
ccgagagcagcaccaatctcaagagcaacttcatcaatttctggcagttctccatcacaa
tttcacaatgaatctccagcgtatggagtttatgctggtgaacgaacggctacgttagga
agaacaatgagaccgtatgctccatcaattgctccatcggattatcggttgccacaggtc
acaccacaatcagaatcacgaatcggccgtcaaatgagccacggatcagagttcggagat
catatgagcggtggtggtggaagcggaagtcaacacggatcatcagactataattccatt
tatcaacctgatcgttacggaactattcgagctggtggtcggactacagtggatggtagc
ttttctattcccagactatcatctgcacaaagtagtgctggaggtccagaatcaccaaca
ttcccacttccaccaccagctatgaattatactggatatgttgcaccgggaagtgtggta
caacaacaacaacaacaacaaatgcaacaacaaaattatggaactattcgaaaatcaacg
gtgaaccgacatgatcttccacctccaccaaattctttgctcactggaatgtcaagtcga
atgccaacacaagatgatatggatgatctaccacctccaccagaatcagttggtgggtca
tcagcgtatggagtgtttgctggtagaacagaatcgtacagttcgagtcagccaccaagt
ctctttgatacgagtgctggatggatgcccaacgagtatttggaaaaagtacgggtcctg
tacgactatgatgctgcaaaagaagacgagttgacacttcgcgagaacgcaattgtctac
gtactgaaaaagaacgatgacgactggtatgaaggtgtcttggatggagtcactgggctt
ttccctggaaactacgtagttccagtatga

DBGET integrated database retrieval system