KEGG   Caenorhabditis elegans (nematode): CELE_C01G12.8
Entry
CELE_C01G12.8     CDS       T00019                                 

Gene name
catp-4
Definition
(RefSeq) Sodium/potassium-transporting ATPase subunit alpha
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C01G12.8 (catp-4)
Enzymes [BR:cel01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     CELE_C01G12.8 (catp-4)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_C01G12.8 (catp-4)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C01G12.8 (catp-4)
  Exosomal proteins of colorectal cancer cells
   CELE_C01G12.8 (catp-4)
  Exosomal proteins of bladder cancer cells
   CELE_C01G12.8 (catp-4)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD Hydrolase_6
Other DBs
NCBI-GeneID: 175120
NCBI-ProteinID: NP_497034
WormBase: WBGene00007248
Ensembl: WBGene00007248
UniProt: G5EFV6
Position
II:join(14593626..14593964,14594498..14595133,14595190..14595477,14595524..14595962,14596007..14596341,14596498..14596792,14596844..14597336,14597391..14597613)
AA seq 1015 aa
MFGCFKKKKTNKSLEDLKKDVVIDDHEIPLDALFKRYTTSEKNGISEAEATNRLNRDGPN
ALTPPKQTSKWIKLAGSIFGGFNFLLWCAASASAVGYGMDLSMSDDEEVPKDNMYMAIIL
ATVVTVTGLFDFYQNRKSGNLMDSFANMIPPKTLVVRDGATREIEVKDLVVGDLVRFRGG
DRVPADLRVTLARGLKVDNSSLTGESEPQTRNMNCTSKNALETKNLCMFSTSVLEGSGEG
IIIGTGDRTFVGRIAALTTQVDPGPTPLAKEINHFIKIISIVAFTVGIAFFILALVYEYP
PLKAIVFFMGIVVANVPEGIVPTVTVSLTLTAVKMRKKFCLVKKLQAVETLGSTSTICSD
KTGTLTQNRMTVTHLWFDGKIKDTEILPPNDHFKGEKKYEKEDSYQKLLRCATLCSRSHF
RVPEFDVPLAKRVVNGDASEVAIMRYCEMIRGDGQVDEFRKIMPKIGEIPFNSTNKYQLS
IHPMSKKQNILVMKGAPEKILKLCSTYYQNGETKNVSKKFEKEFQQAYETLGSYGERVLG
FCDLEMSTTKFPPGFKFNMEEPNFPIKNLRFLGLISMIDPPRPGVPEAVRVCQNAGIRVV
MVTGDHPITARAIANQVHIIEENVQVTEIVNADPKCDPASDEIYGKGRLKPTGAVVIHGE
QLTTMSPKTLKAVVTNYHQIVFARTSPAQKLQIVEAFQSVGNIVGVTGDGVNDAPALRKA
DIGIAMGITGTDVSKQAADMILLNDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEIT
PFMSYVLFGLPLPMSIIAILMIDLGTDLWPAISFAYEVPESDIMQRAPRNPLYDKLVNKR
LVMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSY
ESRKALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFV
LNTPFVNEVLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFIRTYPGGYIYKETYY
NT seq 3048 nt   +upstreamnt  +downstreamnt
atgttcggatgcttcaaaaagaagaaaacgaacaagtcgctggaggatcttaagaaagat
gtggtcatcgacgatcatgagataccgctcgacgccctgttcaaaagatacaccacatcc
gaaaagaatggaatatcggaagccgaagcaacaaatcggttgaacagggacggtccgaat
gcactgacgccacccaaacaaacttccaagtggatcaagcttgctggttcgattttcggt
ggatttaactttctactttggtgtgccgcaagtgcttctgccgttggctatggaatggat
ttgtcgatgagcgacgacgaggaggttccaaaggataatatgtacatggctataattctg
gcgaccgtagtcaccgtcaccggattgttcgatttttatcaaaaccgaaaaagtggaaat
ttgatggactcttttgccaacatgattcccccgaagaccctcgttgttcgagatggagcc
acaagagaaatcgaagtcaaagatcttgtagtcggtgatcttgttcggttcagaggcgga
gatcgtgttcccgcagatcttcgtgttaccctagcgcgaggcctgaaagttgacaactcg
agtttaaccggagaatcggagccccagacaagaaacatgaactgcacaagcaaaaacgcg
ctggagacgaagaatctgtgcatgttcagtacgagtgttttggaaggatctggcgagggt
atcatcattggaaccggggaccgcacgtttgtcggacgaatcgctgcattgactactcaa
gtggacccaggacccactccattggctaaggagatcaatcatttcatcaagatcatttca
atcgtcgcctttaccgtaggaattgcgtttttcatattggctcttgtctacgagtatcca
cctctcaaagctattgtcttcttcatgggaattgtggtggcaaatgttccagagggaatt
gttccgactgtaacggtgagcctcactcttactgccgtcaaaatgcgcaaaaagttttgc
cttgtgaagaagcttcaagccgttgaaacacttggctcgacgtcgacaatttgttcggat
aaaacgggaacactcacccagaaccgaatgactgtcacgcatttgtggtttgatgggaag
attaaggataccgagatcctaccgccaaatgaccattttaaaggcgaaaagaagtatgag
aaggaggactcgtaccagaagttgcttagatgtgccacgttgtgcagtcgttctcatttt
cgagtacctgaattcgatgtacctctagcaaaacgagtagtaaatggagatgcctccgaa
gtagccatcatgagatactgcgagatgattcgaggggatggtcaagtagatgagttccga
aaaatcatgccaaagattggagagattccgttcaactctaccaacaaataccaattgtct
atccatccgatgtctaaaaagcaaaacattcttgtgatgaagggtgctccggaaaagatt
ctcaagctgtgctctacgtattatcagaatggagagacaaagaacgtatcgaagaagttt
gaaaaggagttccagcaggcctacgagacacttggatcatacggagaacgagtcttagga
ttctgtgatttggagatgagtacgacgaagttccctcccggatttaagttcaacatggaa
gaacccaatttcccaatcaaaaatctccgcttcctcggcctaatttctatgattgatcca
cctcgcccaggtgtccctgaagcagttcgagtgtgtcaaaacgctggaattcgagttgta
atggtgaccggagatcatccaatcacagctagagcaattgccaatcaagtgcacattatt
gaggaaaacgtgcaggtcacagaaattgtgaacgcggatccgaaatgcgacccagcaagt
gatgagatctatggtaaaggacgtctgaagccaacaggagcagtggttattcatggagag
caactgactaccatgtcgccaaaaacgttgaaggcagtggtcaccaattatcaccagatc
gtcttcgcccgaacctctcccgctcaaaaacttcaaatcgtcgaagccttccaatcggtc
ggaaacattgttggagtcacaggagacggtgtgaatgatgccccggcgctccgaaaggct
gatatcggaattgcgatgggaattactggaaccgacgtctcaaaacaggcggctgacatg
attttgctcaatgataattttgcgtcaattgtgactggtgttgaggagggacgtctgatc
tttgataatctgaaaaaatcaatcgcctacaccttgaccagcaacattccagaaatcaca
cccttcatgtcgtatgtcctgttcggtcttccacttccaatgtccatcatcgccattctc
atgatcgatcttggcactgatctctggccagccatctcatttgcatacgaggttccagaa
agcgacatcatgcagagagctccgcgtaatccgctctacgacaagctcgtcaacaaacga
ctcgtcatgttctcctacatgcaaatcggagcgattcaagcgtgcgccggcttcaccacc
tactttgtgttgatgatgtcgaacggatggttcccgcaggatttgttgaatattagtgag
caatgggataacaagtatatcgatgatttggaggacagttatggacaacaatggagttat
gaaagccgaaaagctctggagtcttgctgttatggtactttcttcttcacgattgtggtc
acccagtggtctgatttgtttgcttcgaaaactagaaagaactctttggttatgcaagga
atggaaaaccatgtgctcaatacatcagtgatcttcacctgcttcttggcaatatttgtt
ctcaacactccgtttgtgaatgaagtcttgggagttcaaggattccgattggaaattgga
tttctcgcattgccgttcgcattcttcattggcttgtatgacgaggttagaagatatttc
attcggacttatcctggtggatatatctacaaagagacctactattga

DBGET integrated database retrieval system