KEGG   Caenorhabditis elegans (nematode): CELE_C02E7.1
Entry
CELE_C02E7.1      CDS       T00019                                 

Gene name
catp-2
Definition
(RefSeq) Cation_ATPase_N domain-containing protein
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C02E7.1 (catp-2)
Enzymes [BR:cel01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     CELE_C02E7.1 (catp-2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_C02E7.1 (catp-2)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C02E7.1 (catp-2)
  Exosomal proteins of colorectal cancer cells
   CELE_C02E7.1 (catp-2)
  Exosomal proteins of bladder cancer cells
   CELE_C02E7.1 (catp-2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD RdRP
Other DBs
NCBI-GeneID: 182114
NCBI-ProteinID: NP_504328
WormBase: WBGene00015338
Ensembl: WBGene00015338
UniProt: O16436
Position
V:join(4934738..4934741,4934800..4934899,4935662..4935859,4935909..4935977,4936026..4936182,4936260..4936427,4936477..4936990,4937034..4937199,4937250..4938912,4938972..4939085)
AA seq 1050 aa
MTLLFGVKRWLRRGDEASDSKADASKEVNQQNLSLSFNEHHLDMRQLSEKFSMSKLDIVD
PKVSRGLSKQVAAERLESDGRNALSPPKVISNWKLFLRQFKNLLWILMFGAAALSLVAYI
YDPSDLTNLCVGIFIIVIIFVMCIVSFFEEKKGVEVVRAFQSLMPLSCQVIRDGVEQTLN
PEELVVGDIVVVRSGCKVPADIRVIACTDFYLETSSITGEAEPLEFNSAMADQKTSIFES
YNIAFNGSFCVDGEGYGIVIRTGERTVIGQIASMTLDQKEQKCKFQVEIGRFVKFITVMA
IIMAVIIFSVGLGINKGHDVIRYFVTGFLMVIIANVPQGLPTTVTTELTIIARRMAKKNV
FLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTDLWYNNSYNSGRPENRRRSTKTRFSIT
SNPAQSFDAPLSDLLSVVCVCNKARIENTVTVNRPPPNVDSELDMSMYRIQPVKEMTIVG
NPSEVALLRYASAMLDAKELRESFQVVFEIPFNSVRKYHLILATNKNTWNQVDKNDDVEF
VVMIKGAPEVLIKNCSTMNINGESKELDLKRMEDFNEAYEAFGDEGCRVIGFAQKKFRAR
ASTVFSLKSNTVPMEDWDFLGMSAIMDPPRDDTPKAIKACKAAGIKVYMVTGDHKSTATA
IARQIGMIDTEEVSRVDHNQQIIRRSNSQDWAVITGSELPALTQKQWDELLQHRYIVFAR
TTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLD
DNFSSIVAGIEEGRLLFDNLRKTIAYTMAHMWPELVPVILNFFFGFPLGLTPVQILSIDL
ISDIPPAVSLAYEGPEADIMLQPPRKKDTHLVTKGLITYTYLFMSIFISIGCVCAYLLSY
YINGIGPWELAFTASTYFKHGAANFTTAKGVILNEEQQMYMANQAAAAFHISLVLGQAFH
LWMCLTRRVSIFAHGLGNIVAIFAVIIDLLLICIFTFVPGVKYIFGSQPPPWQCWLVPIV
VGVWIWIFNELRKLGIRKYPKNKFVRLTKW
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgacattacttttcggggtgaaacgatggcttcgtcgcggcgatgaagcttctgattca
aaagctgatgccagcaaagaagtgaatcagcagaatttatctctatcgttcaatgaacat
catttggacatgaggcaactatctgaaaagttctcaatgtcgaaattggatattgttgac
cccaaggtttctcgaggattgagcaagcaagtagctgcggagaggcttgaaagtgatgga
agaaatgctctatcaccaccaaaagttatcagtaattggaaattgtttttgcgacaattc
aaaaatctcctatggattttaatgtttggagctgccgctctttctttggtcgcctacatt
tacgatcccagtgatctcacaaacctttgcgtcggaattttcatcattgtgatcattttt
gtgatgtgcattgtgtcgttttttgaagaaaagaaaggtgtggaagtggtccgtgcattc
cagtcattgatgcctctttcctgtcaagtgatcagagatggagtagagcaaactttaaac
cctgaggagcttgtcgttggggacattgtcgttgtccggtccggatgcaaagtcccggct
gatatccgagttatcgcatgcacagatttctaccttgaaaccagctcgatcaccggagaa
gccgaaccgctggaattcaactcggctatggctgatcaaaaaacgtcaattttcgaatca
tacaacatcgcatttaatggatcattttgtgtcgacggagagggttacggtattgttatc
agaactggcgagcgaactgtgattggacaaatcgcatctatgacacttgaccagaaagag
caaaaatgcaagttccaagtggagattggtcgcttcgtgaagttcattaccgtaatggct
attatcatggccgtcatcattttctccgttggtctcggaataaacaaggggcatgatgtc
attcgatactttgtcaccggttttctaatggttattattgcaaatgtaccacaaggactt
ccaactacagtaaccactgagctgacaattatcgctagaagaatggcgaagaaaaacgtg
tttttgaagaagttggagaaaattgacagcgttggagcgactactctaattgcttctgat
aaaactggaacccttacgaaaaattgcatgactgtaactgacttatggtataacaacagt
tataatagtggccggcccgaaaaccgcagacgctccaccaaaaccagattttcgatcact
tcaaatccagctcagtcattcgatgctccactttcagatctactttcagtggtttgtgtg
tgcaacaaagcgagaatagagaatactgtcacagttaaccggccacctccgaatgtcgac
tccgagctagacatgtcaatgtaccgcatacaaccagtcaaggaaatgacaatcgttgga
aatccatcagaagttgctcttctcagatatgcatctgcaatgttagatgcgaaagagctc
cgggagagtttccaagtggtttttgaaattccattcaactctgttagaaagtatcatttg
attttggcaaccaacaagaatacttggaatcaagtcgataaaaatgatgacgtggaattt
gttgtgatgatcaagggtgctccggaagttcttattaaaaattgctcaacgatgaatatt
aatggagaatctaaagagcttgatttgaaaagaatggaagatttcaatgaagcttacgaa
gcatttggagatgaaggatgccgagtgattggatttgctcagaagaagttccgagctcgt
gcctccacggttttctcgctgaaatcgaatacagttcctatggaggattgggactttttg
ggaatgagtgcaatcatggatccgccgagagatgatacccctaaagcaatcaaagcttgt
aaagcagctggaattaaagtctacatggtaactggagatcacaaatcgacggccacagcg
attgcccgtcaaattggaatgattgatacggaagaagtcagtagagtcgatcacaatcag
caaataattagaaggagtaactctcaagattgggcggtgatcactgggtcagaacttcca
gcattgacccagaaacaatgggatgaacttctccaacatcgctacattgtctttgcaaga
acaacacctgaacataagctgatgattgtgacagaaagccaaaaacgaggagaatgcgta
acagttactggagatggtgtcaacgatgcgcctgctttgaagaaagctgatgtaggagtt
gcaatgggactcgctggaagtgacgtggcaaagcaagcagcagatattattcttctcgat
gacaacttttcttcaatcgttgcaggcattgaagagggacgtctactttttgataatctc
cgaaaaacaatcgcctacacgatggctcacatgtggccagaacttgtgcctgtaattctc
aactttttttttggattcccacttggcctgacacctgttcaaattctctcaatcgacttg
atttctgatattccgcctgctgtatcgctagcctacgagggaccagaagcagacatcatg
cttcagcctcctaggaaaaaggacacacatcttgtcactaaaggtcttatcacttacacg
tacctgtttatgtcaatcttcatctcaattggatgtgtatgtgcatatctgctatcctac
tatattaatggaattgggccctgggagttggcattcaccgctagcacttatttcaagcat
ggagctgcaaattttaccactgctaaaggagtcattttaaatgaagaacaacaaatgtat
atggccaatcaggcagctgcagcgttccatatctcattggttcttgggcaagcatttcat
ctttggatgtgtttaacccgccgtgtttcgatttttgctcacgggctgggaaatattgtt
gcaatctttgctgttatcattgatctccttctcatttgcatattcacctttgttccagga
gtcaagtatattttcggatctcagccaccaccatggcagtgctggcttgtaccaattgtt
gtcggagtttggatttggattttcaacgagctgaggaaactaggcattaggaagtatcct
aaaaataagtttgtgaggcttacaaaatggtga

DBGET integrated database retrieval system