KEGG   Caenorhabditis elegans (nematode): CELE_C04A11.4
Entry
CELE_C04A11.4     CDS       T00019                                 

Gene name
adm-2
Definition
(RefSeq) ADAM (disintegrin plus metalloprotease) family
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Reprolysin Reprolysin_5 ADAM_CR Disintegrin Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 181489
NCBI-ProteinID: NP_510291
WormBase: WBGene00000074
Ensembl: WBGene00000074
UniProt: G5EDW5
Position
X:join(13687973..13688169,13688483..13688531,13688701..13688770,13688986..13689084,13689512..13689663,13689951..13690022,13690073..13690239,13690290..13690374,13690700..13691233,13692165..13692337,13692389..13692602,13692701..13692782,13692881..13692995,13693043..13693150,13693508..13693600,13693648..13693918,13694034..13694167,13694213..13694342,13695310..13695423)
AA seq 952 aa
MTDTLDLKLSSRRQWNPVRCPVRLEVDGSAQTPTSLVQTALNNPSFDLVIAAPNGQNVYI
PFTEDRKLFTANIADDPSTSSLISHCHFEGVTEDGRHALSLCDPGEITGLLMTQTNRFGL
STSNNGSFVLIPYVENNCDLGSLVHSSSRKKRQIGKQNTVIDRNPSYIREHLDGRKRFVE
LALVADYSVYTKYDSDEKKVNDYMQQTMNILNSLYFPLNIRITLVHSEIWKKGDQISVIP
DSKETLNNFMEYKKIMLKDHFFDTGYLMTTLKFDEGVVGKAYKGTMCSYDYSGGIYVDHN
NDTVETVATFAHELGHTFGMDHDPNDKDVCYCPMPRCIMNPQSGHMEVWSECSVKNLASG
FNRGIDLCLFNEPGKKPSDAKCGNGIVEPGEECDCGPLKCDNHCCNGSTCKLIGEAECAS
GDCCDLKTCKPKPRATVCRAAIGICDLDEYCNGETNDCPADFFVQNAALCPGKENEFCYE
GGCGSRNDQCAKLWGPTGKNGDENCYRKNTEGTFHGNCGTNAHTKEIKKCETENAKCGLL
QCETQAERPVFGDPGSVTFSHSTVYSSLKRDDKKFCYVFKSAYGGLNAPDPGLVPDGAIC
GEEQMCIGQKCHKKEKISKVTAQCLDNCNFRGVCNNVGNCHCERGFGGIACEIPGYGGSV
NSNEAYRFRGITLSSTFLVFFCLFGIFIGGLCVYYRVKRKRNLVSEWWSVVKKKFDLHGD
LVPVRKAPPPPYAQRIRQSFTAMWGEDHSHVAVAQPAHPRNCYNSCCRQPPRFDPPSIPM
VTLKNPNLASPTPLLNPAEKEEQNQERATHQHVELYPVAESFRSDSAASFNTRTGSFRPN
VQPPPVPRPSDDVLSKLNEDLAKEKNAKFDRLNKTLPLPPPLPKEKPKTASSTSLRRNES
IRPEQAPPPPPPAHAKPTLPTKQPKVSEDAAATEEKVDVRSMAAIFDQKLKK
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgaccgacacacttgatctgaagctatctagtcgtcgtcaatggaacccggtgagatgt
ccagttcgtctggaagtcgacggaagtgctcaaactcccacatctctagtccaaacagcc
ctcaataatccgtcattcgacctggtgattgccgcgccaaacggtcaaaatgtgtacata
ccgtttacggaagatagaaaactattcaccgcaaacatcgccgacgacccatcgacttca
tctttgatttcgcactgccactttgaaggtgtaaccgaggatggacggcatgcattgtcg
ctgtgcgatccaggagaaatcacgggacttcttatgacgcaaaccaatcggttcggtctt
tccacctccaacaacgggtctttcgttttaataccatatgtggagaacaattgtgatctc
ggctcactagtccattcctcgtctcggaaaaaacgtcagattggaaaacagaatactgtg
atagatcgtaatccatcatacatcagggaacatctggatgggaggaagcgatttgtcgag
ttggcgctggtcgccgactattctgtgtataccaaatatgactctgacgagaagaaagtg
aacgactacatgcagcaaaccatgaacattttgaactcgctctattttcctctcaacatc
cggatcacgttggttcactctgaaatctggaagaagggagatcaaatttcggtgattcca
gattcaaaagagacgttgaacaattttatggaatacaagaagattatgctcaaggatcac
ttttttgacactggatacttgatgacaactctaaaatttgatgaaggtgtcgtaggaaaa
gcatacaaaggaacaatgtgctcgtatgattattctggaggaatttatgtggaccacaac
aatgatacggtcgaaacagttgcgacttttgctcacgaactcggccatacatttggaatg
gatcatgacccgaatgacaaggacgtgtgctactgtccaatgccacgatgcatcatgaat
ccccaatctgggcatatggaagtttggtcagaatgtagtgtaaagaacttggccagtggt
ttcaatcgtggtattgacttgtgtctgttcaacgagcccggcaagaagccaagcgatgca
aagtgcgggaacggaatcgtcgagccaggcgaggagtgtgactgtggaccattgaagtgt
gacaaccattgctgtaatggcagcacttgtaagcttatcggagaagctgaatgtgcatct
ggagactgttgtgacttgaaaacttgcaagccaaagccaagagcaactgtgtgccgagca
gcaatcggaatttgtgatctggacgagtattgtaacggagaaacaaacgattgtccggca
gacttttttgttcaaaatgctgcattgtgtccaggaaaggaaaatgagttctgttacgaa
ggtggctgtggtagtcgaaacgatcaatgcgcaaagttatggggtcctactgggaaaaat
ggcgatgagaactgctatcgtaaaaacactgaaggaacctttcatggaaactgcggaaca
aatgctcacaccaaggagattaagaaatgtgaaactgaaaacgcaaaatgcggtctgttg
cagtgtgaaacccaggctgaacgcccagtatttggagatccgggttccgtcacattttcg
catagcacagtgtactcctcgttgaagcgtgatgacaaaaagttttgctacgtattcaaa
tctgcatatggtggcttaaatgctccggatccgggtcttgttccagatggagcaatttgt
ggtgaagaacagatgtgcattggtcaaaagtgtcataaaaaggagaagatcagcaaagtg
acagcccaatgtttggacaactgcaacttccgtggagtctgcaacaatgttggaaattgt
cactgtgagcggggttttggtggaatcgcttgcgaaattccggggtatggaggatccgtc
aacagtaacgaagcgtacagattccgaggaattacactgtcgtcgacattcttggtattt
ttctgcttgtttggaatttttatcggtggtctttgtgtttattacagagttaaacggaag
cgaaatttggtctcggaatggtggagtgttgtcaagaagaagtttgatttacacggagac
ctcgtacccgttcgcaaagctcctccgccaccctatgctcaacgaattcgccaaagcttc
actgcaatgtggggtgaagatcattctcatgtggcggtcgctcaaccggctcatcctcga
aattgctacaactcgtgctgtcgtcaaccaccacgttttgatccaccgtcaattccaatg
gttactttgaagaatccaaatcttgctagtccaacgccattgctgaatccagcagagaaa
gaagagcaaaatcaagaaagagcaacgcatcagcatgtggaactctatccagttgcggaa
agtttcagaagtgattcggcggcttccttcaacacgcgcactggatccttccgtcccaat
gtacaaccaccgcccgttcctcgaccgagtgatgacgtactgagtaaactgaatgaggac
ctggcaaaggagaaaaatgcgaaatttgatcgactaaacaaaacgttgccactgccacca
ccactacccaaggaaaaaccgaaaactgcaagttctacgagcctgagaagaaatgagagt
atacgacccgagcaggcaccaccaccacctccaccagcacatgctaaacctacactccct
acgaagcaacccaaagtctctgaagatgcagctgcaaccgaagaaaaagtagatgttcgc
tccatggctgctatatttgatcaaaagctcaaaaaataa

DBGET integrated database retrieval system