KEGG   Caenorhabditis elegans (nematode): CELE_C09F9.3
Entry
CELE_C09F9.3      CDS       T00019                                 

Symbol
glna-1
Name
(RefSeq) ANK_REP_REGION domain-containing protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00220  Arginine biosynthesis
cel00250  Alanine, aspartate and glutamate metabolism
cel00470  D-Amino acid metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_C09F9.3 (glna-1)
   00220 Arginine biosynthesis
    CELE_C09F9.3 (glna-1)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    CELE_C09F9.3 (glna-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CELE_C09F9.3 (glna-1)
SSDB
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 175130
NCBI-ProteinID: NP_001293582
WormBase: WBGene00007480
Ensembl: WBGene00007480
UniProt: U4PRW7
Position
II:complement(join(14720552..14720591,14720732..14720784,14721397..14721749,14722129..14722253,14722303..14722455,14722708..14722892,14723222..14723470,14723600..14723809,14724840..14724945,14725167..14725317,14725490..14725863,14727198..14727504,14727896..14728049,14733414..14733524))
AA seq 856 aa
MDFGHLLDKIHEEVAEDPGEMADESSSSDDDVAHENDKLPKTTKITVKMSTSVPEKGGIF
DALRVDSNDPNDSLREELCVTPKIDEKNLEYIGEVLERKKSVVPFLTQTINQLALVRNEK
MERAADLICTLFRLPHGSTDCSFFRLIKVLRSFGIWENDPRLKQMFDRMKKHDEENEDSR
QWAMSQEKFKEIIFPCTILISRTLRNQLIIPSWLEFTQLIETIFETCRESKEGEVASYIP
QLARQSPHLWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHVLHQYVGH
EPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFMLKQYRKLAGGGHV
GFDNATFLSERDTADRNYALSYYMKEYRCFPDESQVYEKAKGLREELDLYFQLCSLETNC
DTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQVGLPAKSGV
SGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDKFNFHNYDSLLHPDDSRKIDP
RRKIGPRENETIVQVMYAAKNGDLDSLRRMFMQGADLKTADYDNRTALHVAAAEGRIKVC
KFLINIVGIPHDVRDRWGRYPLDDARQFKNKEVALYLFRLQYPTKRMPENWFEVGGDLLV
SELEPDNSSVDDGEAESSGEDELGNGITGMLTDDLEKREWALHANGNMGEINYQLVRRKS
SKAPPTPDYKPPQFGYGALPVSKYQQQLQLQQQQQQNEKKASQDKHRNINGHGHMNGNGT
HTNGNHQHHQPHQLPQNIPHHMLLNGAAGGLNTRRLSSPNEQDEDNDIVVVLVNRPIEML
DKKRINKDQHIDVDSV
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggactttggccaccttctggataaaatccacgaagaggttgccgaggatcctggcgag
atggctgacgagagcagttcttccgatgatgacgtggcacatgagaatgacaagctgccg
aaaactactaaaatcactgtgaagatgagcacatcggtaccggaaaagggtggaatcttt
gacgcgctacgtgtcgactccaacgatcccaacgattcgctgagagaggagctctgtgtc
acgccgaagattgacgagaagaatctcgaatacatcggggaagtgcttgaacgaaagaag
tccgtggtaccatttctcacccaaaccatcaatcagctggctctggttcgaaatgagaaa
atggaacgagccgccgacttgatctgtaccctattccgccttccacacggatcaactgat
tgctcattcttccgactcatcaaagtgctccgatcgttcggaatttgggaaaatgatccg
aggctgaagcagatgttcgatcgaatgaagaagcacgatgaggagaatgaggattcgcgg
caatgggctatgtctcaggagaagtttaaggaaataatcttcccgtgcacaattttgatc
tcgcgtaccctccgcaatcagctaatcataccctcatggctagaatttactcaactcatc
gaaacaattttcgaaacgtgccgagagtcgaaagaaggtgaggtcgcttcctacattccg
caattagctcggcagagtccgcatctatggggaatgtcgatctgtacgatcgatggacaa
cgattctcgttgggtgattcgaagaagaacttctgccttcaatccgtctccaaagctttc
aactatgcaattgttgcgtcggaaatcggaagtcacgtgcttcatcaatatgttggtcat
gagccaagtggacggctttttaatgagatttgtctcgattcgaataacatgccgcacaat
ccgctaatcaatgctggcgcaattgttgttacgtcaatgattaagccaacacattcgatg
gctgatcgtttcgattttatgctcaaacagtaccggaaactggccggcggaggtcatgtt
ggattcgataatgccacattcctgtcagaacgtgacactgctgaccgaaactacgcatta
tcgtattacatgaaagagtatcgatgctttccggacgaatctcaggtctatgaaaaggca
aagggactgcgtgaagagcttgatctctacttccaactgtgctcactggagaccaactgt
gacacggctgcagtcatggccgctacgttggcaaatggtggaatctgtccgttgacgacc
gagaagtgtttgggatcccgtccgtgtcgtgatattttgtcgctgatgtactcgtgcgga
atgtatgattattcaggaaaattcgcgtttcaggttggacttccagccaaatccggtgtc
tctggtatcatgattgtggtcattccaaatgtgatgggaatcgcactctactcgccgcca
ctcgacaaaactggaaattcgtgtcgtggagtcgcgttctgtcgtcagctcatcgataaa
ttcaacttccataattatgattcgttgctccatcctgatgattcaaggaaaatcgaccct
cgtagaaagattggaccacgagagaatgagactattgtgcaggttatgtacgctgcaaag
aatggagatttggattccctccgccgaatgttcatgcaaggagccgatctcaagactgcc
gattatgataatcgtacggcgctccacgtggcagccgctgagggaagaatcaaagtgtgc
aagtttttgatcaatattgtcggaattccacatgacgttcgcgatagatggggccgctat
ccactggacgatgcccgccagttcaagaataaagaggtcgcgctctacttgttccgtctc
caatatccaacaaagagaatgccggagaactggttcgaagttggcggagatcttctcgtt
tcggaacttgaacccgataactcaagcgtcgatgacggagaagccgagagctctggagag
gatgagcttggaaatggaataactggaatgttgactgacgatttggagaaacgagagtgg
gcgcttcatgctaatggaaatatgggcgaaatcaactaccagcttgtcagaaggaaatca
tcaaaagctccaccgacgcccgactacaagccaccgcaatttggctacggtgctcttcca
gttagcaagtaccagcagcagcttcaacttcagcagcaacagcagcaaaacgaaaagaaa
gccagccaagacaagcatcgtaacatcaatgggcatggacatatgaatggcaatggaact
cacacaaacggcaatcatcaacatcaccagccccaccagctcccgcaaaacattccacat
catatgctgctcaacggtgccgccggagggctcaatacgcggaggctcagctcgccgaac
gagcaggacgaggataatgacatcgttgtggtgctagtgaaccgaccaatagagatgtta
gacaagaaaagaattaataaggatcaacacatcgacgtggatagtgtctaa

DBGET integrated database retrieval system