KEGG   Caenorhabditis elegans (nematode): CELE_C14C11.6
Entry
CELE_C14C11.6     CDS       T00019                                 

Gene name
mut-14
Definition
(RefSeq) MUTator
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII PhoH SecA_DEAD
Other DBs
NCBI-GeneID: 178952
NCBI-ProteinID: NP_504490
WormBase: WBGene00003507
Ensembl: WBGene00003507
UniProt: Q17978
Position
V:complement(join(5658874..5659119,5659168..5659335,5659384..5659892,5659982..5660509,5660569..5660704))
AA seq 528 aa
MSYPWSNKNGEAASSSKTTVAPPLSPPRYEKVLDFSTLDTQRHRYEVRDQANQRAVVSSA
KAESSMIDKFCKENTRIQTNPGIDLPDDYGTDAIVANAIGDQRIVNNLKCVHVTTFNAVQ
QMSIQVIREGRGLVVEAPTGIGKTYAFLIPAIEAALKNRQSNCFEYTKPSPSILIMASTS
ALVDQLFNRCELILGLQCMDNVEPIRDIKIDKLVANHPFTKGQCDIAFCTIGKLKATIEC
GDVCLDNLKTIILDEADKMIDNCAFGPDINWILDQLKEENLENLQSCFFSATYNKNANGT
IALTVLQMRMLGEDDPWSVIICPRMSGYITQRVVRVGRGRPNDIRSHPWVIKMGIIRKLI
DDDLKETGCSKDGPYNETIAIFCETVQRVTQVTMALRQLGYNFKPVCSMITKNQQLVTVN
DLEFRKIHGVVCTNILARGIDVSSVKHTIIMEMSADFDTYKHRIGRVGRDGCGGKSTVLV
EHHQLQGGPASNVIEQLYNFMKESKEDIPQWMQEWIVARRNNNIDSWA
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgtcatatccctggagtaacaaaaacggcgaagcggcgagttcatcaaaaactactgtc
gcgccaccattgagtcctcctcgttacgagaaagttcttgatttcagcacactcgacaca
caacgtcatcgttatgaagtcagagatcaggcaaaccaacgtgcagttgtctcgtcagca
aaagccgagtcttccatgatcgacaaattctgcaaggaaaataccagaattcaaacaaat
cctggcatcgatcttcccgacgactacggtaccgatgcgatcgttgcgaatgcaatcggt
gatcaaagaatagtaaacaatttgaaatgtgtccacgttaccacgttcaacgcagtacaa
caaatgtcaattcaagtgattcgagaaggacgagggcttgttgtcgaggcaccaacgggt
attggtaaaacatatgcatttttgatcccggcgattgaagccgcattgaaaaatcgtcaa
tcaaattgcttcgagtacacgaaaccgtcaccttcgattttgattatggcaagcacatcg
gctttggtggatcagcttttcaatcgctgtgaactcattcttggattacagtgcatggac
aatgttgagccaatccgtgatatcaagattgataaacttgtcgctaaccatcctttcact
aaaggccaatgcgacattgcattctgcacaatcggcaaactgaaagcgacgattgaatgt
ggcgacgtatgccttgataatttgaaaacgattattctggacgaagctgataaaatgatc
gacaattgtgctttcggtcccgacatcaattggatcctggatcaactgaaggaagaaaat
ctggaaaatctacagtcgtgcttcttctcggcaacctataataaaaatgcgaatggcaca
attgcattgactgtacttcaaatgagaatgttgggagaagacgatccgtggtcagtcatt
atttgcccaagaatgtcaggatacatcacacagcgagttgtaagagtgggaagaggaagg
ccaaatgatattcgttcacatccctgggttatcaaaatgggaatcattcgcaaattgatc
gacgatgatctgaaggagactggttgcagtaaagatggaccttataatgagacgattgcc
attttttgtgagactgtccaaagagttactcaggtaaccatggctctccgtcaattggga
tacaatttcaagcccgtatgcagcatgatcacgaaaaatcagcagctcgtcactgttaat
gatttggaattccgaaaaattcacggagttgtctgcaccaacatcttggcaagaggaatt
gacgtgtcatctgtgaagcatacaatcatcatggaaatgtcggcagactttgacacctac
aagcacaggattggtagagttggacgagacggatgtggcggaaaatcgacggttctagtt
gaacatcaccaactgcaaggaggaccagcttcaaatgtaatcgaacaactttacaatttc
atgaaggaaagtaaggaagatattccacaatggatgcaggagtggatcgtcgctcgtcga
aacaacaatatcgactcatgggcttaa

DBGET integrated database retrieval system