KEGG   Caenorhabditis elegans (nematode): CELE_C17H11.6Help
Entry
CELE_C17H11.6     CDS       T00019                                 

Gene name
C17H11.6
Definition
(RefSeq) RBR-type E3 ubiquitin transferase
  KO
K11972  E3 ubiquitin-protein ligase RNF19A [EC:2.3.2.31]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cel04121]
    CELE_C17H11.6 (C17H11.6)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     CELE_C17H11.6 (C17H11.6)
Ubiquitin system [BR:cel04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    CELE_C17H11.6 (C17H11.6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IBR zf-C3HC4 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 181076
NCBI-ProteinID: NP_001123112
WormBase: WBGene00015926
Ensembl: WBGene00015926
UniProt: B1Q249
Position
X:complement(join(8185637..8185970,8186434..8186617,8188074..8188178,8188225..8188405,8188777..8188844,8189810..8189956,8190168..8190314,8190593..8190796,8191084..8191296,8191346..8191563,8192244..8192354,8192414..8192496,8192546..8192656,8193133..8193301,8194652..8194762,8203377..8203623,8203731..8203779))
Genome map
AA seq 893 aa AA seqDB search
MSSNKCGLDPLEEEPSIESQPILHTATPPVQHRRKISEEVSATRPCQIRATPSKSTESSS
VANVGSIVANHRPSRKCGSRLSLTSLLSFTGHSSFSRDRSRSGWSYSDDNAGHVAMTSVS
SSDVRSNVSGSISSKRYRGSDTGSGMDSEAGETCAEMLLSSRNQDDEEQSDEKQLSQSLP
DTPKTPSEVGKKGKGKMKECPLCAAKMPGSAFPKLKGCQHRSCRACLRQYVELSITENRV
EVPCPECSSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIAT
KCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQS
ADSTLKPGDVKACPRCKTYIVKMDDGSCNHMVCTMCNAEFCWLCLKEISDLHYLSPTGCT
FWGKKPWTRKKKLLWQLGTLIGAPVGIALIAGLSIPGIVFGVPVFVGRKVHQRFKYKSKT
KRRFLTATCVVGSLVVSPVMAVMAVGVGVPIMLAYVYGVVPLSLCRNGGCGLSSSDSSLA
LADIDEEQLYGTPGASAPVDLSQFMTDASKREDIVSIDPSILSMPREMKTRYYPKGRRTS
LESGERVNYEEASVKAMAGSHHYDDKSVHTLCSGHEVTSLNDEQSSTKALAGSVMDTKSM
SESMYRHMILTKYAEKQHHQENDDDHDEQGGSDDQPSTSSAVHHIKGPKLSSSSIHRGCV
IERDDDGLLFTEEGAALLINSPPAMRSSGSVNIDPIDLFKIRSWLDNMKQMVATDAPQET
PYEPSTRPSSKLRRSGSGKSVHTVATFPVNLNTGNTVNRQGLSNLSKPEIVQNMSNAPSE
AGITVAAPRSPTELEANGENAGDDSVSTSSSSRSQKKKKRRFGIFSNWFNKTK
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaacaaatgcggtctcgatccacttgaggaagagccaagcattgaatcgcag
ccaattctccacacggcaaccccaccggtccagcatcgtcgcaaaatatcagaggaggtg
tcggcgacgcgaccgtgtcaaataagagccacaccttctaaatcaaccgaaagttccagt
gttgcaaatgtgggttccattgttgccaaccatcgaccgtctcgaaagtgtggctcgcgt
ttgagtttgacaagcttgctcagtttcactggacattcgtcgttttcacgtgacagatct
cgctcgggttggtcatacagcgacgacaacgctggtcacgtcgccatgacaagcgtttcc
agcagcgacgtacgcagcaacgtctccgggtcaatatcatcaaaacgttaccgtggtagc
gatactggttccggaatggacagtgaagccggtgagacttgtgctgagatgctgctctcc
tcgcggaatcaagatgacgaggagcagtcggacgaaaaacaactgtcacagtcactgcct
gacactccaaaaacaccgtcagaagttgggaaaaaggggaaaggcaaaatgaaagagtgt
ccactttgtgctgcaaaaatgccaggcagcgcgtttccaaaattgaagggatgccaacat
cggagttgcagggcgtgccttagacaatacgtcgaattgtcgatcacagaaaatcgggtt
gaagttccatgtccagaatgttcatcatatttgcatcctaatgatattaaaatgcttatt
ggggacattccaacacttattgaaaagtatgaagcatttagtctccgtcgttacctcatg
actgaagcggatgcacgttggtgcccagcaccggattgcgggtttgtcttcattgcgacc
aagtgtgcagcatgtccgcaactaaaatgtcaacgtccagattgtgggacgttattctgc
taccattgtaaacgcgaatggcactctaatcaaacttgtgatgaagctcgtcgacccgaa
aagcgaaaaagtcgcgggttggcattcgaagagattatgcgcacaggtttccatcagagc
gccgactcaacactcaagcctggagatgtaaaagcgtgcccgcgctgcaagacgtatatt
gtgaagatggatgatggatcgtgtaatcacatggtgtgcacaatgtgcaatgcagagttt
tgctggctttgtcttaaggaaatctcagatttgcattacttgagcccaacgggatgcacg
ttttggggaaaaaagccatggacgaggaaaaagaagctactctggcaacttggaactctc
ataggtgctccagtgggaatcgccttgattgccggcctctcaattcccggaattgtgttt
ggtgtgccagtttttgtgggcagaaaagtgcatcaacgattcaagtacaaatcaaagaca
aaacggcgttttctcaccgctacgtgtgttgtaggatcgctagttgttagtcccgtgatg
gcagtgatggcagtcggtgttggagtccccattatgctggcttacgtctacggggtcgtc
cccctgtcactttgccgtaatggtggatgtggtctttcgtcttccgactcgtctctcgcg
ctggcagatatcgacgaagagcaattgtacggaacaccgggagctagtgctcctgtcgac
ttatctcaattcatgacggatgcgtccaaacgggaagacattgtgtccattgatccgtcg
attctgtcaatgccacgtgagatgaaaaccagatattacccaaaaggaaggagaactagt
ttggagtcgggtgaacgggtcaattacgaggaggcaagcgtaaaagcaatggccgggtct
catcactatgacgataagagtgtacacaccttatgctcgggacatgaggtgacttctttg
aatgatgaacaatcaagcaccaaagctcttgccggctccgtgatggatacgaagagcatg
agcgaaagcatgtacaggcacatgatattgacaaagtatgccgagaaacaacaccatcag
gagaatgacgatgatcacgacgagcaaggtggaagtgatgaccaaccatcgacgtcttcc
gcagtccatcatatcaaaggaccaaaactttcgtcgtcttccatacatcgtgggtgtgtg
attgagcgcgacgacgatgggcttcttttcaccgaagaaggtgctgcgttgctgatcaat
tcaccacctgcaatgcgcagctctggaagtgtgaatatcgatcccatcgatttattcaaa
attcgtagctggcttgataatatgaagcaaatggtagccactgacgcacctcaagagaca
ccttatgaaccttcaacgcgaccaagtagcaagctccgaagatcaggaagcgggaagagt
gtgcatacagtagccacgttcccagtcaacctcaacaccggtaacacggtgaacaggcag
ggactctcgaatttgtcgaaaccagaaattgttcaaaatatgagcaacgctccttcggag
gctggaattactgtcgccgcgccacgtagcccgacagaacttgaggcgaacggtgagaat
gctggcgatgacagtgtgtcgacaagttcttcatccagaagtcagaaaaaaaagaagcga
cgttttggaatattcagtaattggttcaacaaaacgaaataa

DBGET integrated database retrieval system