KEGG   Caenorhabditis elegans (nematode): CELE_C34F6.2
Entry
CELE_C34F6.2      CDS       T00019                                 

Gene name
col-178
Definition
(RefSeq) Col_cuticle_N domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Collagen Col_cuticle_N
Other DBs
NCBI-GeneID: 181307
NCBI-ProteinID: NP_509869
WormBase: WBGene00000751
Ensembl: WBGene00000751
UniProt: O17641
Position
X:join(11199476..11199533,11199583..11200376)
AA seq 283 aa
MEDKAKLVQASELKKFAFFGVAVSTVATLIAIIAVPLLCLHMQTVHSGLSDELLFCKSKN
VDMRSEIEKLSVIRDNGRQKRQTPQTCCSCGIGETGPAGVPGQEGAPGNDGKAGQPGAPG
ADADEQGFHYKAPEFCFDCPAGPPGAVGGPGPKGPPGPPGGPGELGGPGRGGNRGPPGPR
GPPGEAGPDGEGGRPGQAGQTRSAPSPPGQPGQPGEPGSPGEPGPDGRAGHPGRNGPPGP
PGDNGGQGEPGKDGEDGENGAAGAAGPKGSCDHCPPPRTAPGY
NT seq 852 nt   +upstreamnt  +downstreamnt
atggaagacaaggcaaagcttgtacaggcgtccgaactcaaaaagtttgccttcttcgga
gtggcagtctccactgttgctactttgatagcaattattgctgtcccacttctttgcctt
catatgcaaactgttcattctggtctttccgacgagcttcttttctgcaaatcaaagaat
gttgacatgagaagcgaaatcgagaagctttccgttattcgtgacaacggaagacagaag
cgtcaaactccacaaacttgctgttcatgcggtattggagaaactggaccagctggagtt
ccaggacaagaaggagcccctggaaatgacggaaaagctggacaaccaggagcaccagga
gctgacgctgacgagcaaggttttcattacaaggctccagaattctgcttcgactgccca
gctggaccaccaggagccgttggaggaccaggaccaaagggaccaccaggaccaccagga
ggtccaggagagcttggaggaccaggacgtggaggaaaccgcggaccaccaggaccacgt
ggaccaccaggagaggctggaccagacggagagggaggacgtccaggacaagccggacaa
actcgctcagctccatctccaccaggacaaccaggacaaccaggagaaccaggatcgcca
ggagagccaggaccagatggacgtgctggacatccaggacgtaacggaccaccaggacca
ccaggagacaatggaggtcaaggagagccaggaaaggacggagaagatggagagaacgga
gctgctggagccgctggaccaaagggatcttgcgaccactgcccaccaccacgcactgcc
ccaggatattaa

DBGET integrated database retrieval system