KEGG   Caenorhabditis elegans (nematode): CELE_C50F4.13
Entry
CELE_C50F4.13     CDS       T00019                                 

Symbol
his-35
Name
(RefSeq) Histone H2A
  KO
K11251  histone H2A
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_C50F4.13 (his-35)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C50F4.13 (his-35)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    CELE_C50F4.13 (his-35)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_C50F4.13 (his-35)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 179339
NCBI-ProteinID: NP_505463
WormBase: WBGene00001909
Ensembl: WBGene00001909
UniProt: Q27485
Structure
PDB: 
6K00 6K09 6K03

Position
V:complement(join(9544768..9545001,9545134..9545283))
AA seq 127 aa
MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK
KTAGDKE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtccggacgtggaaagggaggaaaagctaagaccggtggaaaggccaagtcccgttcg
tcgagagctggacttcaattcccagttggtcgtcttcatcgtattctccgtaaaggaaac
tacgcacaacgtgttggagcaggagcaccggtgtacctcgcagcagttctggagtacctc
gccgccgaagttctcgagttggctggaaacgctgcccgtgacaacaagaaaacccgtatt
gcaccaagacatctccaactcgctgtccgtaatgacgaggaattgaacaaactgttggct
ggagtcaccatcgcccaaggaggagttcttccaaacatccaagccgtgcttctcccaaag
aagactgcaggagacaaagaataa

DBGET integrated database retrieval system