KEGG   Caenorhabditis elegans (nematode): CELE_F12F6.9
Entry
CELE_F12F6.9      CDS       T00019                                 

Gene name
col-128
Definition
(RefSeq) COLlagen
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Collagen BetaGal_dom3 Col_cuticle_N
Other DBs
NCBI-GeneID: 178076
NCBI-ProteinID: NP_502175
WormBase: WBGene00000702
Ensembl: WBGene00000702
UniProt: Q19368
Position
IV:complement(join(11550047..11550092,11550142..11550233,11550373..11550888,11550939..11551427,11551797..11551937))
AA seq 427 aa
MWLYTLAALSISFSCLLIIVQVIYFPYLISQAESAHGIVMSKIESFKNLESEITRELSDF
TFLHVARKREIISCEPGYPGLPGSNGRDGQAGNDGPNGIRGLDARDIMEEIQANQECITC
PQGERGPTGAPGDRGETGDKGDKGVAGIPGQDGLDGEQGEEGPVGPSGPPGRRGRKGADG
KSAMGGFGSPGPKGVPGAKGGSGLQGPRGKRNYIYGPPGPMGQPGPSGLDGVSGNPGERG
PKGPPGDRGADIKFCPCPLELELLKGKHSKSVRPSPPASPSSTSQPTTSATTTSEPLSPS
TTIVTDAPELVTTETSTEDLAVMEDITATTTMETITFASQDLGKEEIREPENVFGRAPGA
ETGPQGGNEIEVLNYDDEEIRTIELPKEYEHEETRGPIITEEEDDYPEETTTTRRFRYVT
KRPIRFE
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtggctttatactcttgccgctctatcaatttctttctcatgtcttctaataatagtt
caagttatttactttccctacttgatttcacaagctgaatcagctcatggtattgttatg
agcaaaattgaatcttttaagaatctcgaatcagaaataactcgtgaactatctgacttc
accttcctccatgtcgccagaaaacgtgaaataatatcatgtgaacccggatatccaggt
cttcctggttcaaatggtcgagatggacaggctggaaatgatggaccaaatggaatacgt
ggattggatgctcgtgacataatggaagagattcaagcaaatcaagaatgtatcacatgc
ccacaaggagaacgtggaccaactggggcaccgggagatcgtggagaaactggagataag
ggagataagggagttgctggaattccaggccaagatggtttagatggagaacaaggagaa
gaaggaccagttggaccatcgggacctcctggaagaagaggaagaaaaggagctgatggt
aaatctgcaatgggtggatttggatcacctggaccgaaaggtgtgccaggagcgaaggga
ggatccggattgcaaggtcctcgaggaaaacgcaactacatctacggcccgcctggtcca
atgggtcaacctggaccatctggattggatggagtatctggaaatcctggagaaagaggg
ccaaagggaccaccaggagatagaggagctgatattaaattctgtccatgtcctctagaa
cttgagcttttgaagggaaaacactcgaaatcagttcgtccgtcaccaccagcgtctcct
tcttcaacatctcagccgactacatctgcaacaacaacttccgaaccattgtcaccttct
accactattgtaacagatgctccagaacttgttacaactgaaacttcaacagaagatctt
gcggtaatggaagatatcactgccacaactacaatggaaactataacctttgcttcacaa
gacttaggaaaagaagaaattcgagaaccagaaaatgtgtttggaagagctcctggagcc
gaaacgggaccgcaaggagggaatgagattgaagtattgaattatgacgatgaggaaatt
cgcacgattgaacttccaaaagaatatgaacatgaagagacacgtggcccaataattacc
gaagaggaggacgattatcctgaagaaactaccactacccgacgattccgttatgtcacg
aagcgtccaattcgatttgaataa

DBGET integrated database retrieval system