KEGG   Caenorhabditis elegans (nematode): CELE_F14F4.3
Entry
CELE_F14F4.3      CDS       T00019                                 

Gene name
mrp-5
Definition
(RefSeq) Multidrug resistance-associated protein 5
  KO
K05668  ATP-binding cassette, subfamily C (CFTR/MRP), member 5
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CELE_F14F4.3 (mrp-5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_F14F4.3 (mrp-5)
Transporters [BR:cel02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    CELE_F14F4.3 (mrp-5)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 AAA_29 MMR_HSR1 AAA_16 Dynamin_N ATP-synt_ab DUF87 DUF815
Other DBs
NCBI-GeneID: 181587
NCBI-ProteinID: NP_510479
WormBase: WBGene00003411
Ensembl: WBGene00003411
UniProt: G5EE72
Position
X:complement(join(14938942..14939171,14939417..14939588,14939639..14940247,14940306..14940696,14940742..14940910,14941460..14941589,14941635..14941781,14941834..14941966,14942012..14942307,14942805..14942885,14942931..14943254,14943304..14943473,14943526..14943891,14943937..14944084,14944144..14944408,14944453..14944686,14944736..14944807,14944860..14945024,14946066..14946170,14946241..14946317))
AA seq 1427 aa
MPSDSEEVCLQQSGTGVYENVVYSKETSDRAKRYAGDTNRKTIGRYSAAVQNLIPLRTTE
RNKNNGGSRIDDAGLFSFVTYSWVFPYLYQAVRGKLDRNQVWGCSFYDSCGLNMARLEVL
WEDEKKANAKSPSLFKVIYRFISTRLWFSCAVFFFCLIFGFIGPTCFIRRLIAFAENPER
DEQSRIVYSYGIALVAAISVVEFARVLSYGATWAVSYRTGIRVRGAVLALLYKNVLNSKD
LCGKTESDVINIFANDGQRLFDAVTFAPLVLVGPLVLVGGIGYLLMVIGRWSLLGILVFF
VFDVIQFGLGKSMVACRNLAIVKTEKRISMMAEIIKYIRIVKMNGWEQIFSAKIDQFRKE
EKVQIRKSGYAQSLAIACGPVVPVVAAILTFVGVVLAGNDLLASDAFSAITVYFVMLFGI
RMIPYGSRYLAEAVVAMRRIQEYLLLEQYAPYPVTNAEDVVLDCQGATYTYQPKAAKAPV
DETKEPTENEVIVVETPVFTCSFDKLSIKRGEHIAVIGAVGCGKSAILKAISGHMFTTDD
ALSVDRSQTVYVPQKAWIFNGTVQDNILFGDKMNSERYYKAVNGCQLTEDLTTLSVGDRT
EVGERGATLSGGQKARVALARAVFQTKNLYLFDDIFASLDKKVANKIHEEIIQKLLKKKA
LMMVTNNMELLHHFDRVLFVEGGNIVADGNHDILYEKNDAYKTFVDACETYQATSGATSP
CGDGPAQPAPLDAEILRNSSEDLKGDADKLISDEEDMGNSTIAWRIYKQYIHAAGGWPIW
TCLVIGFIVNVVSNIFSTYWLSRWLKKGHDETTTITNGTEFLEMKTSLADSPVTGFYAAV
YLVALVVLTISGLFKACVFVKVSLTAATRLHDRMFQAVIHGATSFFDSTPTGRILNRFSK
DMDEIDVKLPFTAEVFLQNMITCLGFLVVITSVFPYFLLFAIPLFVVFVVFVSCFRAGIR
NLKRSEHISRSPLYDHVSASLEGITTIHTFQQSNRFLEVLKKHLDCNSGAIFMFQSAMRW
LAVWLDLLVVVMTAIVALLTVMLTGTVSPADAGMAIAFAVQMSGIFQFAVRTQTELEAKM
TSVERVSYYADNIPEDGEWNTRQGLDIESSWPANGQINFSEVNLRYRKSHPLALNDITFE
IKGGEKVGIIGRTGSGKSSLANLIFRLYPVTNGTIYIDGVDIRTVGLVKLRRGISAIAQD
PSLFSGTVRFNLDPSLEYSDSMIWEALEKCHLKTLVQSLDKKLEADVSHGGNNFSVGERQ
LFCLARALLMKSRIVILDEATASVDAGTDKLIQEVIKTVFADATVIIIAHRLDNVRNMDR
IMHLKNGKLINFTTPQEMFKDDWSVYKLEDKDDDQHSAVVVGENSEHSMEKSSQGSSQES
DDIVKVENEQKDSSDDVVHIESGDDDVKADSSEVKETSSDTDIEVVQ
NT seq 4284 nt   +upstreamnt  +downstreamnt
atgccctcggacagcgaggaggtctgcctccagcagtcggggacaggcgtctacgagaat
gtggtatattcgaaagaaacatcagacagagccaagcgatatgcaggtgatacaaatcgt
aaaacaattggaagatactcggcagcagtacaaaatctaattccacttagaaccacagaa
agaaacaaaaacaacggtggcagccgaatcgacgatgccggactcttctcctttgtcacc
tactcttgggtgttcccttatttgtaccaagcagtacgtggaaaacttgaccgaaatcaa
gtttggggatgcagtttttatgacagttgtggtttaaatatggctagattggaagtgtta
tgggaagatgagaagaaagccaatgcaaaatcaccgtcattattcaaagttatttatcga
tttatcagcactcgtctctggttttcctgtgcagtgttcttcttttgcctgattttcgga
tttattggaccaacttgcttcatccggcgactcatcgcctttgcagaaaacccggaacgt
gacgagcagagcagaattgtgtactcttacggaatcgcactggtagccgctatcagcgtc
gtcgagtttgcacgagtcttgtcttacggagcgacttgggcggtctcttacagaactgga
atcagagtacgcggagccgtcctggctctcctctacaagaacgtgttaaactccaaggat
ctatgtggaaagaccgagtcagatgtcatcaacattttcgccaatgatgggcaacgtctt
tttgatgccgttacatttgcgcctttggtgctcgttggaccattggttcttgtcggaggt
attggatacctactgatggttattggaagatggtcacttctcggtattcttgtgttcttt
gtgtttgatgtgattcagtttggactcggaaaatccatggtcgcgtgtagaaatctggca
atcgtgaagaccgagaaacgtattagcatgatggctgaaattattaaatacattcgaatt
gtcaagatgaacggatgggagcagattttcagcgcgaaaattgatcaattccgcaaagaa
gagaaagttcaaatccgtaaatcgggatatgctcaatcactagccattgcatgtggtcca
gtcgtcccagttgttgctgcaattctcacatttgttggagtcgtccttgccggaaatgac
ctccttgcttctgacgcattttcagctatcactgtctactttgtcatgctcttcggtatc
cgaatgattccatatggatccagatacttggcggaagctgtggttgccatgagaagaatt
caagagtatttgttgctggagcaatatgccccatatccggttacaaacgcagaggatgta
gttcttgactgtcagggggctacctacacttatcagcctaaagctgcaaaagcaccagtt
gacgagactaaagaaccaactgagaatgaagtgattgtcgtggagacccctgtattcacg
tgctcatttgacaaactctcaatcaaacgtggagagcatatcgcggttattggagctgtt
ggatgtggaaagtcagctattctcaaggctatttcgggtcatatgttcaccaccgacgac
gccctttcagtggatcgctcgcaaaccgtgtatgtcccacaaaaagcgtggatcttcaat
ggaaccgtacaagataatattttgttcggcgataagatgaactctgaaagatactacaaa
gccgtgaacggatgccaacttactgaagacttgacgacactctcagttggagaccgaaca
gaagttggagaacgaggggccacactttccggaggacagaaagcgagagttgctttggca
agagctgtgttccaaacaaagaatctctacttgtttgacgatatttttgctagtttggat
aagaaggttgctaataagattcatgaggaaatcattcaaaagctattgaagaaaaaggca
ctaatgatggtcaccaataacatggagcttcttcatcactttgatcgagtactatttgtc
gaaggcggaaacattgttgctgatggaaaccacgacatcttatacgaaaagaatgacgct
tacaaaacctttgtagatgcatgtgaaacttatcaagcgacttctggagctacatctcca
tgtggcgacggaccagcccagccagcaccacttgacgctgagattcttagaaattcgtca
gaagatttaaaaggagacgctgataaactgattagtgacgaggaggatatgggaaacagt
acaattgcttggcgtatttacaagcaatacattcacgctgctggcggatggccaatttgg
acatgtcttgtcattggattcatcgtcaacgttgtctcgaacattttttcaacttattgg
ctttccagatggctcaagaaaggacacgatgaaactactactattactaatggaactgaa
tttttggaaatgaagacgagtttggctgacagtcctgtcaccggattttatgccgccgta
tacctcgtggctcttgtcgtgctcaccatctctggacttttcaaagcatgcgttttcgtc
aaggtttctctcactgctgcgacacggctccacgataggatgttccaagccgtcattcat
ggagctaccagcttctttgattcaaccccaacaggaagaatcctgaacagattttccaag
gatatggatgaaattgatgtcaaacttccattcaccgccgaagttttccttcaaaatatg
atcacttgtctgggattcctcgtggttatcacatccgttttcccgtacttccttcttttc
gcaattccactttttgtagtttttgtggtatttgtttcatgcttccgtgctggtatcaga
aatttgaaacgatctgagcacatttctcgctccccactctacgatcacgtttctgctagt
ttggaaggaatcacaactatccacacgttccaacaaagtaatcgcttcttggaggttctc
aaaaaacacttggactgcaacagtggtgctatttttatgttccaatcggcaatgagatgg
ttggcagtgtggctggatcttttagtagttgtcatgacagccattgtcgcacttttgaca
gtcatgctcactggaactgtttcacctgccgatgctggtatggcaattgcattcgctgta
cagatgagtggaatcttccaatttgcggttagaactcagacagagcttgaggcaaagatg
acaagtgtggaaagagtgtcatactatgccgataacattcctgaggatggagaatggaat
actcgccaaggccttgatattgaatcttcctggcctgccaatggacaaatcaacttttca
gaagtgaaccttcgctatagaaaaagccacccacttgccctcaatgatatcacttttgaa
atcaagggtggagaaaaagttggaattattggaagaaccggatcaggaaagtcatcactg
gcaaaccttattttccgactctacccagtcacaaacggaacaatttacatcgatggagtt
gatatcagaaccgttgggctcgttaagcttcgtcgtggaatttcagctatcgcgcaggac
ccatccttgttctctggaacggttcgattcaatttggatccaagcttggagtattccgac
tcaatgatttgggaagccctcgaaaaatgtcatttgaaaacattggtacaatcattagac
aaaaagttggaggctgatgtaagccacggtggaaataacttctccgtcggagaacgacag
ctgttctgtttggctcgtgctttgttgatgaagtcccgaattgtgattcttgatgaggca
acagcttcagtggatgccggtacagataagcttattcaagaagtgattaaaaccgtgttt
gccgatgctactgtgattatcattgctcatcgtctcgacaacgttcgtaacatggatcgt
ataatgcacctgaaaaatggaaaactcataaatttcacaactccacaagaaatgtttaaa
gatgattggtcggtttacaagctggaagacaaagacgatgatcaacattctgcggtggta
gttggagaaaatagtgagcactcgatggaaaagagttcccagggaagcagtcaagaatcc
gacgatattgtaaaagtagagaatgagcagaaagatagctcggatgatgtcgttcacatt
gaaagcggcgatgatgacgtcaaggcggactcttctgaagtaaaagagacgagcagtgac
acagatatcgaagttgttcagtga

DBGET integrated database retrieval system