KEGG   Caenorhabditis elegans (nematode): CELE_F27D9.7
Entry
CELE_F27D9.7      CDS       T00019                                 

Gene name
F27D9.7
Definition
(RefSeq) Peptidase M12B domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Reprolysin Reprolysin_5 Reprolysin_3 Reprolysin_4 Peptidase_M10
Other DBs
NCBI-GeneID: 185019
NCBI-ProteinID: NP_509295
WormBase: WBGene00017865
Ensembl: WBGene00017865
UniProt: Q19844
Position
X:complement(join(7667454..7667724,7667773..7667892,7668476..7668652,7668839..7668972,7669284..7669493,7669943..7670014,7670493..7670591,7670637..7670714))
AA seq 386 aa
MRGIILILALTIYITSAAESFLHAELEDDTEAEIADWSDVKTDGKIRLITFLIGIDSAMT
RYYNYDEARIRSAMIVLMHTVNQYFYPLNIRLSIIDILPVKGTNMGLDDFISWKKEQQNL
IEHDVTVLLRHNYEGGIAYSNGICSKNSLMISGFLPDATMNNAWVFMHQLAHVIGLTHKQ
QTKCECNTAINGRCLKLSGFPECSVQEMVDKLSNSSCLIQESPSFAKNTVVPKKGSLPVC
GNGLQEDEEECDCGPERFCDNILCDAVKCRFIVQKAYLTTFIPLGFAFIAFVILLFGKYC
LCSLFASLRNTGHREQMEKNRGDIENLNDVDVEQAPVRMRVSRNEEPTIPVENRRTRLSD
LYVTMRPISRFWEKFHKQKDGSVAPI
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgagaggaattatactaattttagcactaaccatttatataacaagtgcagcagaaagt
tttttacatgcagaactggaagatgacacagaagcagagatagctgattggagtgatgtg
aaaacagatgggaaaataagacttattacgtttttaattggaattgattcagctatgaca
aggtactacaactatgacgaggcgcgtatacgatctgccatgattgttctaatgcacact
gtgaatcaatatttttacccactcaatatccgcctatcaattattgatatccttcccgta
aaaggaactaatatgggactcgatgatttcatatcttggaaaaaagaacaacagaacttg
attgagcatgacgtcaccgtgttactaagacacaattatgaaggaggaattgcatattca
aatggaatttgctcgaaaaatagtctgatgatttcgggttttctaccggatgcaacaatg
aataatgcatgggtctttatgcatcaattagctcatgtaattggtctaacacataaacag
caaacaaaatgtgaatgcaacacggcaataaatggaaggtgcctcaaactaagcgggttt
cctgaatgcagtgttcaagagatggtcgataaactttcaaatagcagttgtcttatacaa
gaatcgcctagttttgcaaagaatacggttgttccaaagaaagggtctctgcctgtgtgc
ggaaatggattgcaggaagatgaagaagaatgtgattgtggtccagaaagattttgtgac
aacattctgtgcgatgcggtcaagtgcaggttcattgttcaaaaagcatatcttacaact
tttattccattgggctttgcttttattgcttttgtcattctactctttgggaagtactgc
ttatgctctctgtttgcatcattaagaaatactggacatagagaacaaatggaaaagaac
cgcggggacattgaaaatttgaatgacgtggacgtcgagcaagcgcctgttaggatgaga
gtgtcacgaaacgaagaacccacaattccagtggaaaatcgaagaacacgattgagcgac
ctatatgttactatgcgaccgatatcaaggttttgggaaaagtttcataaacagaaagat
ggatctgtcgcgcccatttaa

DBGET integrated database retrieval system