KEGG   Caenorhabditis elegans (nematode): CELE_F42G9.7
Entry
CELE_F42G9.7      CDS       T00019                                 

Gene name
snt-2
Definition
(RefSeq) Synaptotagmin 2
  KO
K15290  synaptotagmin-1
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F42G9.7 (snt-2)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    CELE_F42G9.7 (snt-2)
SSDB
Motif
Pfam: C2 DOCK-C2 PTEN_C2 PI3K_C2 A2M_BRD PLAT CEP76-C2
Other DBs
NCBI-GeneID: 185680
NCBI-ProteinID: NP_497261
WormBase: WBGene00004922
Ensembl: WBGene00004922
UniProt: K8FE10
Position
III:complement(join(786698..786814,787319..787420,787467..787600,788207..788327,789311..789481,789524..789691,789945..790148,793410..793502))
AA seq 369 aa
MWATGAIVCSPVFRILSTCCPIRRGVPTSNGYHPRPKHVDIGNGAVPILSSKPITVQPTN
SDYYEPVNNGTLPLSSSGALIKQYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSD
PYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDD
KMGQLSVPLESIDFGITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEA
RNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVH
LIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMTSRRPVVQWHTLQERM
EKEKKKDDD
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgtgggcgaccggagcaatcgtctgctcgccagtattccggattttgtcgacgtgttgt
ccgattcgtcgtggcgtgccaacgtcgaatgggtaccaccctcgcccaaaacacgtggac
attggaaatggcgccgtaccaattctatcgtcaaaacccatcactgtacagcctacaaac
agcgactactacgaaccagttaacaatggaacacttcctttgtcttcaagtggtgccctt
ataaagcagtatggaaatattcacttccgagttgaatatgactttgagcaatccaagctc
tccgtgactatcgtcagtgcttctgatttacccgcaatggaccggaatgggatgtcagac
ccttatgttaaggtgtacgttctgccagagagaaaacagaaatttgaaaccagaatcatc
agaaacacactgaatcccacatataatgaaacgttccaattttcaatcccgttcaacgag
ctccactcaaaaactctcatgttggtggtatatgactatgaccgattatcgaaggacgat
aagatgggtcaactgtccgtgccactggagtcaattgattttggaattactactgatatc
gaacgacctcttcagaagcccgagaaagacgatgagaaagaatgccgactcggtgatatt
tgcttctccactcggtaccgacctgcaaccggtacagtaacccttacgatcatggaggcc
aggaatttgaaaaagatggatgttggtggttcttcagatccatacgtaaaaatctactta
caccacggacgaaagctgttaagtaagaaaaagacgtcgagaaagtacaaaaccctgaat
ccctactacaatgagagtttccaattcaaaattgagccacatatgattgagaaagttcat
ctgattgtgtccgtctgggattatgacaagatgagcaagaacgactttatcggagaggtg
acgttgggctccaagcatttgaatttaccgcagatcacccacgcgtgcagcgaacagtgg
gctgaaatgatgacgtcacggaggcctgtagttcagtggcatacgttacaagaacggatg
gaaaaggagaaaaagaaggatgatgactaa

DBGET integrated database retrieval system