KEGG   Caenorhabditis elegans (nematode): CELE_F58G6.1
Entry
CELE_F58G6.1      CDS       T00019                                 

Gene name
amph-1
Definition
(RefSeq) AMPHiphysin homolog
  KO
K12562  amphiphysin
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CELE_F58G6.1 (amph-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F58G6.1 (amph-1)
Membrane trafficking [BR:cel04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CELE_F58G6.1 (amph-1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    CELE_F58G6.1 (amph-1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    CELE_F58G6.1 (amph-1)
SSDB
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 BAR_3 COG5 Arfaptin ApoL
Other DBs
NCBI-GeneID: 177797
NCBI-ProteinID: NP_501711
WormBase: WBGene00010272
Ensembl: WBGene00010272
UniProt: Q21004
Position
IV:complement(join(9644687..9645001,9645345..9645410,9645494..9645592,9645877..9645969,9646019..9646174,9646556..9646654,9646703..9646789,9646946..9647026,9647075..9647176,9647224..9647340,9647476..9647589,9647635..9647691))
AA seq 461 aa
MADLFNKHLKKATNRTKEKLLEGIGKAKATQDEVFDQHAANLNKQSKSCEKLHKDVKNYS
SALRTLLSAEKQLRDTIRDAYEPEWPDREHLTAIFDNLDIQTNELEKTVCDDLPQTVTQY
VNQFPDLKKKIEKRGRKLVDYDSAKNSFNSVKASSKKDNDPKLAKATMELQAAEQMYTEM
NNELLEILPAVFDSRITFFVDTLQTLFNANSVYQTDASKFHKQIVMQLDKLGESMDYLRV
ARPEARALTPIDTTSLASSDAPATPDQNKSDNSSLRQTPSPSVLPSPVPAPMAKPRESVV
SMANSTNPFDDDDAEHDKEATPTDVEEKFEAKVYPKLNAQQTAAAEQAIAAAKREKKEAS
NPFDDEDDESTEVEEAPKKKDPEPTPKPLDGITNEKRKTLYFVTSTHNYKAVDTDELSFE
QGVQIKVIEANEDDQLDDGWRLGELEDGKRGVFPENFTKKV
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggctgacttgttcaacaaacatctgaaaaaagcaacgaatcgtaccaaggaaaaactt
ctcgaaggaatcggaaaggcaaaagcaacacaagatgaggtatttgatcaacatgccgct
aatttgaataaacagagcaaatcatgtgaaaagttgcacaaggacgttaagaactactca
tctgctcttcggacccttttgtcagctgaaaaacagttgcgagacacaatacgagatgct
tatgagccagaatggcctgatcgagagcatcttactgctatttttgataatttggacatt
caaacaaatgagctcgagaagactgtatgtgatgacttgccacaaactgttacgcaatat
gtgaaccaatttccagatcttaagaagaagattgaaaaacgtggccgcaaacttgttgat
tatgacagtgccaagaactcgtttaacagtgtgaaagcgtcgagcaaaaaggataatgat
ccaaaacttgcgaaagcaacaatggagcttcaagctgctgagcaaatgtacacagaaatg
aataatgagttacttgaaattttaccagctgtatttgacagtcgtatcacattcttcgtt
gacactcttcagactcttttcaatgccaacagcgtttatcaaactgatgccagcaagttc
cacaagcaaatcgttatgcaattggataaactgggagaatcaatggactatttgagagtt
gctcgtcctgaagcccgagctctcactccaatcgacacgacgtctcttgcatcgagtgat
gctccagctactcctgaccagaataaatctgataactcatctctccgtcaaactccatct
ccatcggttttaccatctccagtgccggcaccgatggcgaaaccgagagaaagtgtcgtc
tcaatggccaactctacaaatccattcgatgatgacgacgccgaacacgacaaagaagcg
actccaaccgacgttgaggagaagtttgaggctaaagtctacccgaaactcaacgctcaa
caaacagctgctgccgagcaagcaattgccgccgcaaaaagggaaaagaaggaagcttct
aatccattcgatgacgaggatgatgaatcaacagaagtagaagaagctccaaagaaaaaa
gatccagaaccaactccaaagccacttgatggaattacaaatgaaaagagaaaaacacta
tactttgtgacttcaactcataattacaaagctgtcgatacagatgaactgagttttgaa
caaggtgtgcagattaaggtaattgaagcaaatgaagatgatcaattggatgatggatgg
agacttggagaacttgaagatggaaagagaggtgtttttccggagaatttcacaaagaag
gtgtag

DBGET integrated database retrieval system