KEGG   Caenorhabditis elegans (nematode): CELE_H36L18.1
Entry
CELE_H36L18.1     CDS       T00019                                 

Gene name
zmp-5
Definition
(RefSeq) ZnMc domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
Motif
Pfam: Peptidase_M10 Hemopexin Astacin Reprolysin_3 Metallopep DUF4953 Reprolysin_4 Peptidase_M57
Other DBs
NCBI-GeneID: 186805
NCBI-ProteinID: NP_001333542
WormBase: WBGene00010423
Ensembl: WBGene00010423
UniProt: O17913
Position
X:join(12647252..12647308,12647389..12647437,12648290..12648390,12648999..12649122,12649179..12649265,12649842..12649976,12650021..12650173,12650214..12650344,12650885..12651029,12651075..12651154,12651332..12651487)
AA seq 405 aa
MTVWRRWWYLYILSGFIINNVMLESKSRVKRYSIEGSYWGKSVITYRLKQPSQRMSLSQQ
KAVFARAFATWEEHTRLWFVAVDDEDEQKANIDIVFAAGDHEDGEPFDGKGNILAHAFFP
RYGGDVHFDEDELWSANKTKGVDLYAVAVHEIGHSLGLKHSSNHLSIMAPFYKQYTGAVM
HLHQDDISAVKRLYGAPVKIRKKASEHHIWRSELCTKPYLDAVTTLKNGTILAFRGKMFF
ELKTTRKWLLPRKINRIFPFEGPLEAATTDRHGNVYFFKKDTYWVMTKHGDMMNGYPKKI
SQGLTDTPDGINAALYYHEDGKPYFFKKSYFWQYSRYGKHKLWPRAIVSIFENQNSPPEI
DAAFQLNNTSSFLFHQNKYWKVSGDPMRIEKGFPRSLSRDWFNCL
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgaccgtttggcggcggtggtggtacctctacatcttatctggattcatcatcaataac
gtaatgttagaatcgaaatcgcgtgtgaagcggtattcaattgaaggatcatactgggga
aagagcgttataacgtaccgattaaagcaacccagtcaacggatgagtttgagccaacaa
aaagcagtatttgcaagagcattcgcgacatgggaagaacacactcgtctctggtttgtc
gccgtggatgatgaagatgagcagaaagccaacattgatatcgttttcgccgccggcgat
catgaagacggagagccgttcgatgggaaaggaaacattctagctcatgcattttttccc
agatacggaggagatgtgcattttgatgaagacgaactatggagcgccaacaaaacaaaa
ggtgttgacttatatgcagtggcagttcatgaaataggccattccctgggcttgaagcac
tcttcaaaccacttatccattatggctccgttctacaaacagtacacgggagcagttatg
catctccatcaagatgacatttctgctgtaaaacggttatacggggcaccagtaaaaata
cgaaaaaaagcgtcagaacatcacatttggagatctgaactgtgtactaaaccgtacctt
gatgcagttaccacattgaagaacggaacaattttggcgttcagaggtaagatgtttttt
gaactgaagacaacacgaaaatggctgttgccaaggaaaataaatcgcatttttccattt
gagggtccattagaagcagctaccaccgatagacatgggaatgtatattttttcaaaaaa
gacacatactgggtgatgacgaaacacggggatatgatgaacgggtatccaaagaagatt
tcacagggactcacagacactcctgatggaatcaatgcagctttatattaccatgaagat
ggaaaaccatattttttcaaaaaatcttatttctggcaatattctcgttacggaaaacac
aagttatggccgcgtgcaattgtgtcgatttttgaaaatcagaattcacctcctgaaatt
gatgctgcattccagttgaataatacttcgtcttttctgtttcatcaaaataaatattgg
aaagttagcggagatccgatgcggatagaaaaaggatttccaaggtctctatcaagagat
tggtttaattgtctctga

DBGET integrated database retrieval system