KEGG   Caenorhabditis elegans (nematode): CELE_K12H4.8Help
Entry
CELE_K12H4.8      CDS       T00019                                 

Gene name
dcr-1
Definition
(RefSeq) Death-promoting deoxyribonuclease
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_K12H4.8 (dcr-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     CELE_K12H4.8 (dcr-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    CELE_K12H4.8 (dcr-1)
   microRNA pathway
    RISC loading complex
     CELE_K12H4.8 (dcr-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_3 PAZ Dicer_dimer Ribonucleas_3_3 Helicase_C ResIII DEAD dsrm
Motif
Other DBs
NCBI-GeneID: 176138
NCBI-ProteinID: NP_498761
WormBase: WBGene00000939
Ensembl: WBGene00000939
UniProt: P34529
Position
III:complement(join(8072110..8072167,8072220..8072599,8072702..8072797,8072846..8073092,8073151..8073317,8073367..8073513,8073564..8073750,8073807..8074032,8074601..8074916,8074960..8075265,8075315..8075496,8075543..8076135,8076196..8076526,8076644..8076794,8076845..8076913,8076955..8077134,8077243..8077609,8077678..8077832,8077879..8078121,8078166..8078294,8078339..8078521,8078954..8079325,8079378..8079517,8079583..8079742,8079788..8079921,8080016..8080178,8080224..8080274))
Genome map
AA seq 1910 aa AA seqDB search
MVRVRADLQCFNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQ
GGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVI
TAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLT
ASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLG
IPNFDTVIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQ
VWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIR
LFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPD
YVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDR
PLDMRSYVQSKGRARRAGSRYVITVEEKDTAACDSDLKDFQQIEKILLSRHRTVNNPIED
DSDRFEEFDVDSQMEPYVVEKTGATLKMSTAIALINRYCSKLPSDIFTRLVPHNQIIPIE
ENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPK
GRESIAKLLEHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADKECFIYAF
ELERFREAELTLNPKRRKFEDPFNYEYCFGFLSAKEIPKIPPFPVFLRQGNMKVRLIVAP
KKTTVTAAQLQEIQLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYT
INMKYVSEVVANMENMPRIPKDEVRRQYKFNAEDYKDAIVMPWYRNLEQPVFYYVAEILP
EWRPSSKFPDTHFETFNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQPRRSR
TVSNSSTSNIPQASASDSKESNTSVPHSSQRQILVPELMDIHPISATLWNVIAALPSIFY
RVNQLLLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIVKKIQQLRDLN
QKSIEDQERETRENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGLTQ
GLHDGNISDEDDELPFVMHDYTARLTSNRNGIGAWSGSESIVPSGWGDWDGPEPDNSPMP
FQILGGPGGLNVQALMADVGRVFDPSTASSSLSQTVQESTVSPPKQLTKEEEQFKKLQND
LLKQAKERLEALEMSEDMEKPRRLEDTVNLEDYGDDQENQEDENTPTNFPKTIDEEIEEL
SIGARKKQEIDDNAAKTDVLERENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEY
VSHIDSDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHE
GKLSFARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAE
EKDNEIERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPY
NLLTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRF
IDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQR
LEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCP
GLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAI
YLDSGRNLDTTWQVIFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKV
RVTVEVVNNMRFTGMGRNYRIAKATAAKRALKYLHQIEQQRRQSPSLTTV
NT seq 5733 nt NT seq  +upstreamnt  +downstreamnt
atggtcagggtaagagctgatttacaatgttttaaccccagggactaccaggtggaactt
ttggataaagcgacaaaaaagaacacaatcgtccaactaggcactggttcaggaaaaact
ttcattgcagttctactgctgaaagaatatggagttcaattgtttgcaccattggatcag
ggtggaaaacgagcgttttttgttgtagagaaagtaaacctcgttgaacaacaagctatc
cacatcgaagttcacacaagtttcaaagttggtcaggtccacggacagacaagtagtggt
ttatgggacagcaaagaacaatgtgatcagttcatgaagaggcaccatgttgttgtgatc
acagctcaatgccttcttgatttgattcgacatgcgtacttgaaaattgaagacatgtgt
gttctgatctttgacgaatgtcatcatgctctcggttctcaacatccatacagaagcatc
atggtcgattataagttattgaaaaaggacaaacccgtcccacgtgtattaggactcaca
gccagtcttatcaaagcgaaagttgcgccggaaaaactaatggaacagttaaaaaagttg
gaatctgcgatggacagtgttatagagacagctagtgatttagtctcgctctcgaaatac
ggtgcgaaaccctatgaagttgtgatcatctgcaaagactttgaaattgggtgcctgggt
attccgaatttcgacacagttatagaaatatttgatgaaactgtagcctttgtgaacacc
acaacagaatttcatccagatctagatttggatcctcgtagaccgattaaagattctctc
aagacgacgcgagctgtttttcgtcaactgggaccttgggcggcatggcgaacggctcaa
gtttgggagaaagagttgggaaaaattataaaatctcaagtgctaccggataagacgttg
cggtttttgaatatggcaaaaacatctatgattacgattaaaagattgttggaaccggag
atgaagaaaatcaaaagtattgaagctctccgtccatatgttcctcaacgtgtcatacgt
cttttcgaaatcctagaaactttcaaccccgaatttcaaaaagaacgaatgaagttagaa
aaagcagaacatttatcagccattatttttgtcgatcaacggtacattgcatattcgtta
cttcttatgatgcgtcatattaaatcatgggagcctaagttcaagtttgtgaacccggat
tacgtcgttggagccagcggacgaaatttggcgagttcggatagtcaaggattacataaa
cgacaaactgaagttcttcgccgtttccatcgaaatgaaatcaattgtcttatcgctaca
tcagtgcttgaagaaggtgtagatgttaaacaatgtaatcttgtgattaaatttgatcga
ccacttgacatgagatcatacgttcagtcaaagggaagagctcggcgagctggatcaaga
tatgttatcactgttgaggagaaagatactgcggcgtgtgatagtgatttgaaagatttc
cagcaaatagaaaaaattcttcttagccgccatcgtacagtcaacaatcctattgaagat
gattcggatagatttgaagaatttgatgttgattctcaaatggaaccatatgttgttgaa
aaaactggtgcaacattgaaaatgtcaactgctatcgcattaattaatagatattgttcg
aagcttccttccgatatcttcactcgtcttgttccacacaatcaaatcattccaattgaa
gagaatggagtgaccaaatactgtgcagagcttcttcttccaattaactcaccgatcaaa
catgcaattgtgctcaaaaatccaatgccaaataagaagactgcacagatggcagttgca
cttgaagcatgtcgacaattacatttagaaggagaactcgatgataatttacttccaaaa
ggaagagagtcgattgccaaattattagaacatattgatgaggagccggatgagtatgca
cctggaattgctgctaaagttggatcatcaaaacgaaagcaattatatgacaaaaagatt
gctcgtgctctcaatgaatccttcgtggaagcagataaggaatgtttcatctatgcattc
gaattggaacgtttccgggaagccgaacttacgttgaacccgaaaagacgaaagtttgaa
gatccatttaattatgaatattgcttcggatttctgagcgcaaaagagataccaaagatc
ccaccattcccagtgtttcttcgacaaggaaatatgaaagtccgattgattgtcgcaccg
aaaaagactaccgtaaccgctgctcagcttcaagagattcaactgttccataattatttg
ttcacacaagttcttcaaatgtgtaaaacgggaaatttggaattcgatggaacatcaaat
gcaccattgaacacgttgattgttccacttaacaagcgaaaagatgatatgtcctacaca
atcaacatgaaatatgtatcggaagtagttgcaaacatggaaaatatgccacgtattcca
aaagatgaagttcgtcgtcaatacaaattcaacgctgaagattataaggatgcgatcgta
atgccgtggtatcgaaatctggaacagcctgtattctactatgttgctgaaattctacca
gaatggaggccgtcgtcgaaattcccggatacgcacttcgaaacgtttaacgagtatttc
atcaagaaatataaattagagatttatgatcagaatcaaagtttattggatgtagatttc
acatctactcgtcttaaccttcttcaacctcgaattcaaaatcaaccacgtcgttcaaga
actgtgagtaactcctcaacgtcaaatattcctcaagcatctgcttctgattcaaaagag
tcgaatacttccgttccacactcttcacaacgtcagatccttgtaccggaattgatggac
attcatcctatctctgcgactctttggaatgttatagcagccctgccaagtattttctat
cgtgttaatcagttattgttgactgatgaacttcgagaaacaattttggtgaaagctttt
ggaaaagagaaaactaaactggatgataatgttgaatggaattctctggcatatgcaacc
gaatatgaagagaaacaaacgataatcgttaagaaaattcaacaattgagagatttaaat
caaaaatcgattgaagatcaagaaagagagacgagagaaaatgataagattgacgatggt
gaggagttattcaatattggagtttgggatccagaagaggcagtcagaattggtgtagaa
attagttcaagagatgatagaatggacggtgaagatcaggatactgtaggactaacacaa
ggacttcatgatgggaatatatccgatgaagacgatgaactgccgtttgtaatgcatgat
tacacagccaggctcacttctaacagaaatggaattggtgcatggtcaggatctgagtct
attgttccaagcggatggggagattgggatggacctgaaccagataatagtcccatgcct
ttccaaattctcggtggaccaggtggtttgaatgtgcaggcactgatggctgatgtcgga
agagtttttgatccatctactgcttcgtcttccctttctcaaactgtacaagaatcgaca
gtttcacctccaaaacaattgacaaaagaagaagaacagtttaagaaacttcaaaatgac
ttgctgaaacaagcaaaagagcgacttgaagctctagaaatgtcagaagatatggagaaa
ccgcgaagattggaggatactgtgaatttagaagattatggagatgatcaagaaaatcaa
gaggatgagaatacaccaacaaatttcccgaaaaccatagatgaagaaattgaagagttg
tcaattggagcccggaaaaaacaagaaatagacgacaatgcagctaaaactgatgtactc
gaaagggaaaactgtgaagttttgccagttgctataaatgaaaagtctcgttcattctct
tttgaaaaagaaagtaaagcaataaatggacgacttataagacaacgatcagaggaatac
gtgtcacatattgattcagatattggattaggagtatctccatgtcttttgttaactgct
cttactacttccaatgctgcagatggaatgtcattagagagattcgaaacaatcggagac
tctttcttgaagtttgctactaccgattatctctatcacacgttgcttgatcaacatgaa
ggaaaattgtcgtttgcacgtagtaaagaagtttcaaattgcaatttgtatcgactgggc
aagaaattgggaatacctcaattgattgttgcaaataaattcgatgctcacgattcttgg
ctgccaccatgctatattccaacttgcgacttcaaagctcctaacactgatgatgcagaa
gagaaagataatgaaattgaacgaattttggatggacaagtgattgaagagaaacctgaa
aataaaactggatgggacattggtggtgatgtctcgaaaagcactaccgatggaatagag
actattacattcccaaagcaagcccgtgttggtaatgatgatatctctccacttccttac
aacttgctcacccaacagcatatttcggataaatcaatcgctgacgcagtcgaagctttg
atcggagtacatttgctgacgttgggacctaatccaacgctgaaggtgatgaattggatg
ggactgaaagtaattcaaaaagatcagaagagtgacgtaccttcacctcttctacgattc
attgacactccgaccaatccgaatgcttctctaaatttcttgaacaatttgtggcagcaa
ttccagtttacacaattggaagagaaaattggatatcgcttcaaggaacgtgcttatctt
gttcaagctttcacacatgcttcgtacatcaataatcgtgtcacaggatgctatcaaaga
ttagaattcctcggagacgctgttctcgactatatgatcaccagatatttgtttgaagat
tctcgtcaatacagtccgggtgttctcactgatttacgatcagctctcgtcaataataca
attttcgcgtcgttagcagtgaaattcgagtttcaaaagcacttcatcgctatgtgccca
gggctttatcacatgattgagaaatttgttaagctgtgctcggagcgcaatttcgatact
aatttcaatgctgagatgtatatggtgactactgaggaagaaatagatgaaggccaagaa
gaggatattgaagttccaaaagcgatgggtgacatatttgaatcagtagctggcgccatt
tatctcgactctggacgtaatttggataccacttggcaagtgattttccacatgatgcgc
gggactattgaattgtgctgtgcgaacccaccaagatcaccgattcgagagcttatggag
ttcgagcagagcaaagttcgattcagtaaaatggaacgaattctcgagagtggaaaagtt
cgagttacagtcgaggttgttaataacatgagattcactggaatgggaaggaactatcga
atcgcgaaagctactgctgcgaaaagagctttgaaatacctccatcaaattgagcagcaa
agaagacaaagcccatcattaacaactgtttaa

DBGET integrated database retrieval system