KEGG   Caenorhabditis elegans (nematode): CELE_M110.1
Entry
CELE_M110.1       CDS       T00019                                 

Gene name
col-76
Definition
(RefSeq) Col_cuticle_N domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Collagen Col_cuticle_N
Other DBs
NCBI-GeneID: 174320
NCBI-ProteinID: NP_495726
WormBase: WBGene00000652
Ensembl: WBGene00000652
UniProt: Q21528
Position
II:join(8204342..8204494,8204541..8204637,8204748..8205168,8206055..8206464,8206516..8206799,8207230..8207364)
AA seq 499 aa
MLVPHSPQSILVVSTVISTFTFLATITLLPLFYMKVQRINSQMLTDLRNCHQDSTDIWKQ
LSQENVRGKRSYGRDAPSIPMGKCCSCQQGKPGPTGPKGPDGGPGQPGLIGLNGRNGRNG
KYVASEAHNEPACQKCPVAPPGPPGHPGRKGPRGTAGNAGTAGKNGIPGRMGPPGPAGVR
GPPGELGMRGPQGDPGKVLNGAPQGQPGRPGKVGSRGKAGHTGRDGRPGLEGTPGTRGVQ
GERGSRGARGPPGPPGPAGSDGRKGSCAHCQSDDKLSQGGANRRPEETDPEGEFSNQQPA
SYEEQPPVITTTTTETAPVYTNPPAHQPVHRSFPSAEPRQSHKNSPSVPVPQEQYNSANS
EVIPKTINYPDTINHQSYKHDGDVSVAGTTDDSEDVNVIPAGQYSSRQYASKTNKIGKAV
HFGYSNDQLSSFVPMGATSEEDENYGKPRAFQTNKGYNVQIMGSGPTYNAAPVGNAWKQP
ENHKVRQYTPQYLPPPAYA
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgctagttcctcattctccgcaatcgatattggtcgtgtcgactgtaatttcaactttc
acatttttggcgaccatcacgcttcttccacttttctacatgaaagttcaaagaataaat
tctcaaatgctcactgatttgagaaattgtcatcaagatagtaccgatatttggaagcaa
ctttcccaggaaaatgtcagaggaaaaaggtcttatggtcgtgatgcgccttcaattcca
atgggcaaatgctgtagttgccaacaaggaaaacctgggcctactggaccaaagggtcct
gacgggggacctggccaaccgggacttattggacttaatggaagaaacggaagaaatgga
aaatacgtagcttcagaagctcacaatgagccagcatgtcaaaaatgtccggttgcaccg
ccaggaccacctggacatccgggacgtaagggtccaagaggtactgcaggaaatgctgga
acagctggaaagaatggaattcctggtcgaatgggaccaccaggaccggcaggagtaaga
gggccaccaggagaacttggaatgcggggaccacaaggagatccaggaaaggtgttgaat
ggagcaccacaaggacaacctggacgaccaggaaaagttggttctagaggaaaagcaggt
catactggaagagacggacgtccaggtctagaaggaactccaggtacaagaggtgttcaa
ggagaacgtggttctcgtggagctcgtggaccaccaggacctccagggccagcaggatct
gacggtcgtaaaggatcttgcgctcattgccagtcagacgataaactaagtcaaggagga
gcaaacagaagaccggaagaaactgatccggaaggagagttctctaatcaacagcctgct
tcctacgaagagcaacctcccgtaatcaccactaccactacggagactgcaccagtttat
actaatccaccagctcatcagccagtgcatcggtctttcccttcagctgaaccacggcaa
tctcataaaaattccccttcggtcccagtgccacaagaacaatacaactctgcaaattct
gaagtaattcccaagacaatcaactaccctgacaccataaatcaccaatcctataaacat
gatggtgatgtaagtgtcgccggaactactgatgatagtgaagacgttaacgtcatccca
gctggacaatattctagccgacagtacgcttcaaagacgaacaaaattggaaaagccgtt
catttcggttattccaatgatcaactctcctcttttgtcccaatgggagccaccagtgag
gaagatgaaaattatggaaaaccaagagccttccaaacaaataagggctacaatgtccaa
atcatggggtccggaccaacatataatgcagctccagtcggtaatgcatggaaacaacca
gaaaaccataaagtccgacaatacactccccaatatctcccaccaccagcctatgcgtga

DBGET integrated database retrieval system