KEGG   Caenorhabditis elegans (nematode): CELE_T09B9.1
Entry
CELE_T09B9.1      CDS       T00019                                 

Gene name
T09B9.1
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Abhydrolase_3 COesterase Say1_Mug180 Peptidase_S9 Esterase_PHB Hydrolase_4
Other DBs
NCBI-GeneID: 181188
NCBI-ProteinID: NP_001024899
WormBase: WBGene00011642
Ensembl: WBGene00011642
UniProt: Q7JMM5
Position
X:join(9757317..9757505,9757841..9758800,9758890..9759036)
AA seq 431 aa
MSLKLEKDPLPIKYLVIGIVTITLLTTAYSLYKPLPDGFTVSKWDRAVMHIVEPALRVAY
YYPSHMFSKASSMVQWTRGALNLLSKSLGLMVNTHGQIDIKWHVWNGTPVKVYQPINNKT
ATNGAVIFIHGGGFALGNVEMYDSLVKRMAFEMRTLFISIEYRLSPETVFPGGIMDCEAA
IEHLFEFGAVQFGIDTSKIVIMGDSAGGNMATVIAQRRAARNAFPKLAGQVLIYPLLQMA
DLQTVSYRYFHSRLNGYALVDPESVVYYYMFYAGINMDEKAYLVPSVISNGHVSDSLKSE
VDKMMEYEHIIESTRTYKNHSIPCRWPVRPSFEAQQLMEPFLNNPDFSPLMKKDVSNLPP
TMVVTCEFDILRDEGLIYAHRLESSGVPTTTINYKNGFHAMLNFHSELNEASNAVYDIER
WTLNAIHTVRH
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgtccctcaaactggaaaaagaccctctcccaattaaatatcttgtcatcggaattgta
acaatcactctactaaccactgcatattcactttacaagccgctgcccgatggattcact
gtcagcaagtgggaccgagcagttatgcacattgttgagccagctctccgcgtggcctac
tattacccgagtcatatgttctccaaagcaagcagcatggttcagtggactcgcggggcg
cttaatctcctgtcaaagtcactgggtctgatggttaacacgcatgggcaaattgatata
aagtggcatgtttggaacggaacaccggtcaaggtctaccaaccaatcaacaataagacc
gcaactaacggagctgtcattttcatccacggtggaggttttgcattgggaaacgtcgag
atgtatgactctttggttaaaagaatggcatttgaaatgagaactcttttcatttctatt
gaatatcgtctttcaccagaaactgtctttcccggtggaatcatggattgcgaggcagca
attgaacatttatttgaatttggagcagttcaattcggaattgatacatcgaaaatcgtg
attatgggtgactcggctggaggaaacatggccaccgtcattgctcaacgtcgtgcagct
cgaaatgcatttccaaagctggcgggtcaagttctcatctatccacttcttcagatggca
gacctccaaacagtctcttaccgatattttcattcccgactgaatggatatgctctagtc
gatcctgaatcagttgtctactattacatgttctacgccggaatcaacatggacgagaag
gcgtatctggttccaagtgtcatttctaatgggcatgtttctgacagtctaaagtcggaa
gttgacaagatgatggaatatgagcacatcatcgaatcgacccgtacatacaagaatcac
agcattccctgtaggtggccagtgcgaccaagttttgaagctcagcaactcatggagcca
tttctcaacaacccggatttttcacctctcatgaagaaagacgtgtctaatttgccaccc
acaatggttgttacttgcgagtttgatattctccgtgatgaaggtcttatttatgcacac
agattggagagctcgggtgttcctacaacaacgatcaattacaagaatggttttcacgca
atgctcaattttcacagtgaactcaatgaagcatccaatgccgtttacgatattgaacga
tggactttaaacgccatccataccgtccgtcactaa

DBGET integrated database retrieval system