KEGG   Caenorhabditis elegans (nematode): CELE_T10C6.11
Entry
CELE_T10C6.11     CDS       T00019                                 

Symbol
his-4
Name
(RefSeq) Histone H2B 2
  KO
K11252  histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_T10C6.11 (his-4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T10C6.11 (his-4)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    CELE_T10C6.11 (his-4)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T10C6.11 (his-4)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931 Endonuc-HincII
Other DBs
NCBI-GeneID: 180072
NCBI-ProteinID: NP_507031
WormBase: WBGene00001878
Ensembl: WBGene00001882
UniProt: Q27894
Position
V:complement(16040144..16040515)
AA seq 123 aa
MAPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggccccaccaaagccgtctgctaaaggagcaaagaaagccgccaagaccgtcaccaag
ccaaaggacggaaagaagagacgtcatgcccgtaaagaatcctactctgtgtacatctac
cgtgtactcaagcaggttcatccagacactggagtctcttccaaggctatgtctatcatg
aactctttcgtcaacgacgtcttcgagcgtatcgctgctgaggcatctcgtcttgctcac
tacaacaagagatccaccatctcttctcgcgaaattcaaactgccgtccgtttgattctg
ccaggagagcttgccaagcacgccgtctctgagggaaccaaggctgtcaccaagtacacc
tccagcaagtaa

DBGET integrated database retrieval system